(data stored in SCRATCH9089 zone)

EMBL: CP000124.PE190

CP000124.PE190       Location/Qualifiers
FT   CDS             complement(203860..204744)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_0197"
FT                   /product="branched-chain amino acid ABC transporter,
FT                   permease protein"
FT                   /note="identified by match to protein family HMM PF02653"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0197"
FT                   /db_xref="EnsemblGenomes-Tr:ABA50431"
FT                   /db_xref="GOA:Q3JXU0"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JXU0"
FT                   /protein_id="ABA50431.1"
FT                   /translation="MDIFGIPVSAMLSQLLLGLVNGSFYAILSLGLAVIFGLLNVINFA
FT                   HGALFMLGAMLAWMGLNYLGLPYWAMLVLAPVVVGLFGILIERSMLRWLYKLDHLYGLL
FT                   LTFGLTLVVEGVFRAIYGSSGQPYDVPALLEGATNVGFMFLPNYRAWVVVASLAVCLAT
FT                   WFVIEKTRLGAYLRAGTENPKLVEAFGVNVPMMVTLTYGFGVALAAFAGVLAAPVIQVS
FT                   PLMGQPMIITVFAVVVIGGMGSILGSIVTGLMLGVVEGLTRVFYPEASATVVFVIMAIV
FT                   LLIRPAGLFGKER"
     MDIFGIPVSA MLSQLLLGLV NGSFYAILSL GLAVIFGLLN VINFAHGALF MLGAMLAWMG        60
     LNYLGLPYWA MLVLAPVVVG LFGILIERSM LRWLYKLDHL YGLLLTFGLT LVVEGVFRAI       120
     YGSSGQPYDV PALLEGATNV GFMFLPNYRA WVVVASLAVC LATWFVIEKT RLGAYLRAGT       180
     ENPKLVEAFG VNVPMMVTLT YGFGVALAAF AGVLAAPVIQ VSPLMGQPMI ITVFAVVVIG       240
     GMGSILGSIV TGLMLGVVEG LTRVFYPEAS ATVVFVIMAI VLLIRPAGLF GKER             294
//

If you have problems or comments...

PBIL Back to PBIL home page