(data stored in SCRATCH9089 zone)

EMBL: CP000124.PE193

CP000124.PE193       Location/Qualifiers
FT   CDS             complement(206900..207679)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_0200"
FT                   /product="branched-chain amino acid ABC transporter,
FT                   ATP-binding protein"
FT                   /note="identified by match to protein family HMM PF00005"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0200"
FT                   /db_xref="EnsemblGenomes-Tr:ABA48827"
FT                   /db_xref="GOA:Q3JXT7"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032823"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JXT7"
FT                   /protein_id="ABA48827.1"
FT                   /translation="MILGDTILETRGLTKEFKGFTAVNGVNLRVRRGSIHALIGPNGAG
FT                   KTTCFNLLTKFLKPTSGQIVYNGIDITDERPSQIARRGVIRSFQISAVFPHLSALQNVR
FT                   IGLQRSLGTAFHFWRSERLLKRLDDRAMDLLTQVGLTDFAHVPTVELAYGRKRALEIAT
FT                   TLAMEPELMLLDEPTQGMGHEDVDRVTALIKKVANGRTILMVEHNMNVIAGISDTITVL
FT                   QRGEVLAQGTYAEVSKNPLVVEAYMGSADAALAGAHA"
     MILGDTILET RGLTKEFKGF TAVNGVNLRV RRGSIHALIG PNGAGKTTCF NLLTKFLKPT        60
     SGQIVYNGID ITDERPSQIA RRGVIRSFQI SAVFPHLSAL QNVRIGLQRS LGTAFHFWRS       120
     ERLLKRLDDR AMDLLTQVGL TDFAHVPTVE LAYGRKRALE IATTLAMEPE LMLLDEPTQG       180
     MGHEDVDRVT ALIKKVANGR TILMVEHNMN VIAGISDTIT VLQRGEVLAQ GTYAEVSKNP       240
     LVVEAYMGSA DAALAGAHA                                                    259
//

If you have problems or comments...

PBIL Back to PBIL home page