(data stored in SCRATCH9089 zone)

EMBL: CP000124.PE196

CP000124.PE196       Location/Qualifiers
FT   CDS             211706..212605
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_0203"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="identified by match to protein family HMM PF00126;
FT                   match to protein family HMM PF03466"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0203"
FT                   /db_xref="EnsemblGenomes-Tr:ABA47766"
FT                   /db_xref="GOA:Q3JXT4"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JXT4"
FT                   /protein_id="ABA47766.1"
FT                   /translation="MDLTLLRAFVAVAREGNLTRAAAQLHLTQPAVSLQIKNLQDLLGI
FT                   ALFVRTSRGLVLTRDGQALLPHAERALDAAADVKRAAAALRHEVRGRLRIGTILDPEFL
FT                   RLGGFLKRLVEAHPQIETALRHGMSGWVLDEVRARELDVGYYIGRPEEDDPRDAERFHT
FT                   VTLTQFRYRVLAPAGWKERVQRARTWRELAALPWIWTPAASAHQRLLSRRFADAGAQPV
FT                   KVAEVDQETSMLDLVKSGVGLTLARDSIALREAHAHALTIVEHVAVPAELTFVTLADRR
FT                   DEPAIAAALRLIDEQWAI"
     MDLTLLRAFV AVAREGNLTR AAAQLHLTQP AVSLQIKNLQ DLLGIALFVR TSRGLVLTRD        60
     GQALLPHAER ALDAAADVKR AAAALRHEVR GRLRIGTILD PEFLRLGGFL KRLVEAHPQI       120
     ETALRHGMSG WVLDEVRARE LDVGYYIGRP EEDDPRDAER FHTVTLTQFR YRVLAPAGWK       180
     ERVQRARTWR ELAALPWIWT PAASAHQRLL SRRFADAGAQ PVKVAEVDQE TSMLDLVKSG       240
     VGLTLARDSI ALREAHAHAL TIVEHVAVPA ELTFVTLADR RDEPAIAAAL RLIDEQWAI        299
//

If you have problems or comments...

PBIL Back to PBIL home page