(data stored in SCRATCH9089 zone)

EMBL: CP000124.PE210

CP000124.PE210       Location/Qualifiers
FT   CDS             complement(225894..228029)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_0217"
FT                   /product="oxidoreductase, FAD-binding family protein"
FT                   /note="identified by match to protein family HMM PF01266;
FT                   match to protein family HMM PF05430"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0217"
FT                   /db_xref="EnsemblGenomes-Tr:ABA49513"
FT                   /db_xref="GOA:Q3JXS0"
FT                   /db_xref="InterPro:IPR006076"
FT                   /db_xref="InterPro:IPR008471"
FT                   /db_xref="InterPro:IPR017610"
FT                   /db_xref="InterPro:IPR023032"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3JXS0"
FT                   /protein_id="ABA49513.1"
FT                   /translation="MRSARLSGRANRLRRGLAEARARFRWILPTPGGTGLSRRFAAFSP
FT                   PSFLFRMTDRIVPATLVFREDGTVVSPLYGDIYHSAAGALAQADHVFIRGNGLPERWRH
FT                   ERAFTIIETGFGTGCNFLATWAAWRADPSHCERLHFVSVEKHPFAREDLRRAAAHIVAY
FT                   TTITTITPIAPLVDELANAWPALTPGVHRLEFDDGRVTLTLVFGDALDVLPNLALRAHA
FT                   FYLDGFAPSKNADLWSPAIFKSLAKLADERATFATYTSSGAVKRALDEAGFAYRKVDGF
FT                   AGKRAMLVGEFAPRWRVRRHEPPRAFSTDRRDAIVIGAGLAGCAVVERLAARGWHVTLI
FT                   ERRERIASEASGNPAGVFHPMIARDDNLAARLSRAGFLHALHRWRALERAGHAFSRSTH
FT                   GLVQLATSDDEFERMRESIDALGVPAELASALSRDDARALLRTDVAHGGWLFAQGGSIS
FT                   PAALAAAQCAAAGDRLSRIVGVEIARLERGGDGRWRALDASGATIAQASVVVVANAADA
FT                   ARIAGLRHAPTQRVRGQLTLLPPGSAPAVPLPVIGDGYVVPLANGVTLTGATYEPDDTD
FT                   ATPREAGHRENLERLERLLPAFSANALDAGALAGRVGFRCVASDRLPLVGELGDEAAAA
FT                   REAAALTGARLRDVPRATGLYGAFGYGSRGLVWATLGAELIAAQIDGEPWPLERELAEA
FT                   IDPARFLVRALRHGRVA"
     MRSARLSGRA NRLRRGLAEA RARFRWILPT PGGTGLSRRF AAFSPPSFLF RMTDRIVPAT        60
     LVFREDGTVV SPLYGDIYHS AAGALAQADH VFIRGNGLPE RWRHERAFTI IETGFGTGCN       120
     FLATWAAWRA DPSHCERLHF VSVEKHPFAR EDLRRAAAHI VAYTTITTIT PIAPLVDELA       180
     NAWPALTPGV HRLEFDDGRV TLTLVFGDAL DVLPNLALRA HAFYLDGFAP SKNADLWSPA       240
     IFKSLAKLAD ERATFATYTS SGAVKRALDE AGFAYRKVDG FAGKRAMLVG EFAPRWRVRR       300
     HEPPRAFSTD RRDAIVIGAG LAGCAVVERL AARGWHVTLI ERRERIASEA SGNPAGVFHP       360
     MIARDDNLAA RLSRAGFLHA LHRWRALERA GHAFSRSTHG LVQLATSDDE FERMRESIDA       420
     LGVPAELASA LSRDDARALL RTDVAHGGWL FAQGGSISPA ALAAAQCAAA GDRLSRIVGV       480
     EIARLERGGD GRWRALDASG ATIAQASVVV VANAADAARI AGLRHAPTQR VRGQLTLLPP       540
     GSAPAVPLPV IGDGYVVPLA NGVTLTGATY EPDDTDATPR EAGHRENLER LERLLPAFSA       600
     NALDAGALAG RVGFRCVASD RLPLVGELGD EAAAAREAAA LTGARLRDVP RATGLYGAFG       660
     YGSRGLVWAT LGAELIAAQI DGEPWPLERE LAEAIDPARF LVRALRHGRV A                711
//

If you have problems or comments...

PBIL Back to PBIL home page