(data stored in SCRATCH9089 zone)

EMBL: CP000124.PE23

CP000124.PE23        Location/Qualifiers
FT   CDS             33242..34510
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_0028"
FT                   /product="MFS permease"
FT                   /note="identified by match to protein family HMM PF07690"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0028"
FT                   /db_xref="EnsemblGenomes-Tr:ABA48949"
FT                   /db_xref="GOA:Q3JYA7"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JYA7"
FT                   /protein_id="ABA48949.1"
FT                   /translation="MNCPADLRTGPAAGRPRTAPAPALTPALTMFFSATVGVIVLNLFA
FT                   AQPLTGPIAAELRLPASLTGLVAMLPQLGYAAGLVLLVPLVDLLENRRLIVTTLAVCAA
FT                   TLALPAVTRSGAVYLAAVFAAGAASSVIQMLVPMAASMAPDERRGRAVGNVMSGLMLGI
FT                   LLSRPLASLIAGAAGWRAFYGAAAAADIAIAAVLAAKLPLRAPQLSTRYAALLRSLWTL
FT                   VATERVLQRRALSAALSMAAFSAFWTAIGLRLAAAPFDLGLHGIAMFAFAGATGAIVTP
FT                   FAGLAGDRGRERDALRGAHVAMLAALAALGVAGAGWGGFDTAAHPALALALLVAGAAAL
FT                   DAGVVADQTLGRRAINLLDPAMRGRLNGLFVGLFFVGGSLGAVLAGAAWAWAGWGAVCA
FT                   VGLVFAGAAFALDWIGAHGPAPR"
     MNCPADLRTG PAAGRPRTAP APALTPALTM FFSATVGVIV LNLFAAQPLT GPIAAELRLP        60
     ASLTGLVAML PQLGYAAGLV LLVPLVDLLE NRRLIVTTLA VCAATLALPA VTRSGAVYLA       120
     AVFAAGAASS VIQMLVPMAA SMAPDERRGR AVGNVMSGLM LGILLSRPLA SLIAGAAGWR       180
     AFYGAAAAAD IAIAAVLAAK LPLRAPQLST RYAALLRSLW TLVATERVLQ RRALSAALSM       240
     AAFSAFWTAI GLRLAAAPFD LGLHGIAMFA FAGATGAIVT PFAGLAGDRG RERDALRGAH       300
     VAMLAALAAL GVAGAGWGGF DTAAHPALAL ALLVAGAAAL DAGVVADQTL GRRAINLLDP       360
     AMRGRLNGLF VGLFFVGGSL GAVLAGAAWA WAGWGAVCAV GLVFAGAAFA LDWIGAHGPA       420
     PR                                                                      422
//

If you have problems or comments...

PBIL Back to PBIL home page