(data stored in SCRATCH9089 zone)

EMBL: CP000124.PE230

CP000124.PE230       Location/Qualifiers
FT   CDS             248858..249328
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_0237"
FT                   /product="LrgA family protein"
FT                   /note="identified by match to protein family HMM PF03788"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0237"
FT                   /db_xref="EnsemblGenomes-Tr:ABA51152"
FT                   /db_xref="GOA:Q3JXQ0"
FT                   /db_xref="InterPro:IPR005538"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JXQ0"
FT                   /protein_id="ABA51152.1"
FT                   /translation="MSRISATAATATRPTTAAPARVGRAARVALQTAALGALWAAIDWT
FT                   VRAFGVPVPSGVVGLAVLLALLLSGRVAPGWVKDGANWLLSDMLLFFIPATVAAVQYGG
FT                   LFKADGWRLALVVVAGTTFVMLSVAIAVDVAAGFERRLAVMRVRAGRRRARA"
     MSRISATAAT ATRPTTAAPA RVGRAARVAL QTAALGALWA AIDWTVRAFG VPVPSGVVGL        60
     AVLLALLLSG RVAPGWVKDG ANWLLSDMLL FFIPATVAAV QYGGLFKADG WRLALVVVAG       120
     TTFVMLSVAI AVDVAAGFER RLAVMRVRAG RRRARA                                 156
//

If you have problems or comments...

PBIL Back to PBIL home page