(data stored in SCRATCH9089 zone)

EMBL: CP000124.PE231

CP000124.PE231       Location/Qualifiers
FT   CDS             249358..250119
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_0238"
FT                   /product="membrane protein, putative"
FT                   /note="identified by match to protein family HMM PF04172"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0238"
FT                   /db_xref="EnsemblGenomes-Tr:ABA48387"
FT                   /db_xref="GOA:Q3JXP9"
FT                   /db_xref="InterPro:IPR007300"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JXP9"
FT                   /protein_id="ABA48387.1"
FT                   /translation="MPFVDGTGSEGRIMTTPDLSFLTAPSSAAISAGCFALTIALYFAS
FT                   KRLYACRKTLFFSPLVLVPAVLVAFVALTGIPYAVYFRDTRWLMWLLGPATIAFAVPIY
FT                   EYRELMKRHWFSLAVGVVVGIAVAICGSLLLSKLLHLSPELQRSLVTRSVSTPFALAVS
FT                   DRIHAPRDLTALFVIATGICGMLVGEFVLALVPLRSRLARGALFGAAAHAVGTAKAREI
FT                   GSEEGVVSSLTMMIAGVAMVLIAPLLTLLPI"
     MPFVDGTGSE GRIMTTPDLS FLTAPSSAAI SAGCFALTIA LYFASKRLYA CRKTLFFSPL        60
     VLVPAVLVAF VALTGIPYAV YFRDTRWLMW LLGPATIAFA VPIYEYRELM KRHWFSLAVG       120
     VVVGIAVAIC GSLLLSKLLH LSPELQRSLV TRSVSTPFAL AVSDRIHAPR DLTALFVIAT       180
     GICGMLVGEF VLALVPLRSR LARGALFGAA AHAVGTAKAR EIGSEEGVVS SLTMMIAGVA       240
     MVLIAPLLTL LPI                                                          253
//

If you have problems or comments...

PBIL Back to PBIL home page