(data stored in SCRATCH9089 zone)

EMBL: CP000124.PE241

CP000124.PE241       Location/Qualifiers
FT   CDS             complement(255959..256510)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_0248"
FT                   /product="transcriptional regulator, MerR family"
FT                   /note="identified by match to protein family HMM PF00376"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0248"
FT                   /db_xref="EnsemblGenomes-Tr:ABA49251"
FT                   /db_xref="GOA:Q3JXN9"
FT                   /db_xref="InterPro:IPR000551"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JXN9"
FT                   /protein_id="ABA49251.1"
FT                   /translation="MRGLSVVIPIRGGHRRSPVRMLAFGRPELHCANSSPLEVKRVGNL
FT                   DIAEVAQRSGVPASALRYYEEKGLIASTGRRGLRRTFDARVLERLALIALGRAAGFSLD
FT                   EVASMFDAQGRPNIDRALLVAKADELDGAIRRLTSMRDGLRHAAACTAPSHMECPKFRR
FT                   ILRAASDARRARKKAPPPGG"
     MRGLSVVIPI RGGHRRSPVR MLAFGRPELH CANSSPLEVK RVGNLDIAEV AQRSGVPASA        60
     LRYYEEKGLI ASTGRRGLRR TFDARVLERL ALIALGRAAG FSLDEVASMF DAQGRPNIDR       120
     ALLVAKADEL DGAIRRLTSM RDGLRHAAAC TAPSHMECPK FRRILRAASD ARRARKKAPP       180
     PGG                                                                     183
//

If you have problems or comments...

PBIL Back to PBIL home page