(data stored in SCRATCH9089 zone)

EMBL: CP000124.PE247

CP000124.PE247       Location/Qualifiers
FT   CDS             260864..262243
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_0254"
FT                   /product="sensor kinase protein"
FT                   /EC_number="2.7.3.-"
FT                   /note="identified by match to protein family HMM PF00512;
FT                   match to protein family HMM PF02518"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0254"
FT                   /db_xref="EnsemblGenomes-Tr:ABA48070"
FT                   /db_xref="GOA:Q3JXN3"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR013727"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JXN3"
FT                   /protein_id="ABA48070.1"
FT                   /translation="MSHSLRGRLLWWLLLPLAVFVAIAGAMSYDTARKTADLVQDGALV
FT                   ASARVIAEDVDWEGGALVANVPPAALELFASPAQDHVYYKVRTGGGRLLAGNPDLDGPA
FT                   APAASGAQPVLFDTALGGLAIRAVAYTRELYNAGNTETVTVVVGKTQTSRQMMIAAIWH
FT                   PQLWRLALMLALAMALVYLGLTFELRPLMKLKEDVADRGPMELEPIRTERLHFELRPIV
FT                   DAINQCIARLNLHAATQRRFIADAAHQLRTPIAVIDTQIQCARQRENGDAALAALLASM
FT                   QRSSRRMADVTDKLLLLAHAEAASPARLAARVDIAAVVSGVLEEAIVLAERRRIDLGAE
FT                   LDDDLQVAGSESLLSALLMNLVDNAVRYAHEGGRVTVSARRDGDAVVLEVVDDGPGIPA
FT                   EARPHVFKRFYRVARDEEGTGLGLAIVEEIAQSHGGAVSLATGPGNRGVRMTVRLPAYR
FT                   N"
     MSHSLRGRLL WWLLLPLAVF VAIAGAMSYD TARKTADLVQ DGALVASARV IAEDVDWEGG        60
     ALVANVPPAA LELFASPAQD HVYYKVRTGG GRLLAGNPDL DGPAAPAASG AQPVLFDTAL       120
     GGLAIRAVAY TRELYNAGNT ETVTVVVGKT QTSRQMMIAA IWHPQLWRLA LMLALAMALV       180
     YLGLTFELRP LMKLKEDVAD RGPMELEPIR TERLHFELRP IVDAINQCIA RLNLHAATQR       240
     RFIADAAHQL RTPIAVIDTQ IQCARQRENG DAALAALLAS MQRSSRRMAD VTDKLLLLAH       300
     AEAASPARLA ARVDIAAVVS GVLEEAIVLA ERRRIDLGAE LDDDLQVAGS ESLLSALLMN       360
     LVDNAVRYAH EGGRVTVSAR RDGDAVVLEV VDDGPGIPAE ARPHVFKRFY RVARDEEGTG       420
     LGLAIVEEIA QSHGGAVSLA TGPGNRGVRM TVRLPAYRN                              459
//

If you have problems or comments...

PBIL Back to PBIL home page