(data stored in SCRATCH9089 zone)

EMBL: CP000124.PE249

CP000124.PE249       Location/Qualifiers
FT   CDS             262971..264599
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_0257"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0257"
FT                   /db_xref="EnsemblGenomes-Tr:ABA49427"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JXN1"
FT                   /protein_id="ABA49427.1"
FT                   /translation="MPPARARLLRPALQLFRCFAKPCRAAARRARLIQPKNARHPVLIP
FT                   RFAWPARKRREGLRPLRWRGRSTRIAQRLRSRRCVLRKNGGQHDIGGDDLETTIPGTFH
FT                   RDGRLRGAASARAVERPALRAHRPERSDLSLAREREGRSRDRHGARRRAVVQRQPLGAE
FT                   GRGGHRRRHEGDLPARKRIHGSRRQHGGPGPDLRPRCVGRRRKRHVRQAHRGLPEHDRA
FT                   RRGGDLRRPLRLGEAHDRGRRLDEREQLQADDLLRGRCDGHALQQRPRVEEAVRQRHLR
FT                   ERGLRVQQFDELRAELDLSGRARLQRRPVQRVGLLQPREPRGLREQVVLGRRQLHVRHL
FT                   PRERRLLPLPGRSGRARPAPGQRVDGVVQGRAEGRARLRARLSADARAQRRVQQRRQRA
FT                   EREHRRLQPHVGRRQRLQGNAVRLGVLPPVEAHRAVPRRRLHAPARRLYGRVHARRDQS
FT                   ARADDRHPHAVLIRRAGRPADASAVPPFALPAPPACSVFPAFFAAPARSPARRGVRRPG
FT                   SCRAFCLPRPFVDEPRGTPSNSAAP"
     MPPARARLLR PALQLFRCFA KPCRAAARRA RLIQPKNARH PVLIPRFAWP ARKRREGLRP        60
     LRWRGRSTRI AQRLRSRRCV LRKNGGQHDI GGDDLETTIP GTFHRDGRLR GAASARAVER       120
     PALRAHRPER SDLSLARERE GRSRDRHGAR RRAVVQRQPL GAEGRGGHRR RHEGDLPARK       180
     RIHGSRRQHG GPGPDLRPRC VGRRRKRHVR QAHRGLPEHD RARRGGDLRR PLRLGEAHDR       240
     GRRLDEREQL QADDLLRGRC DGHALQQRPR VEEAVRQRHL RERGLRVQQF DELRAELDLS       300
     GRARLQRRPV QRVGLLQPRE PRGLREQVVL GRRQLHVRHL PRERRLLPLP GRSGRARPAP       360
     GQRVDGVVQG RAEGRARLRA RLSADARAQR RVQQRRQRAE REHRRLQPHV GRRQRLQGNA       420
     VRLGVLPPVE AHRAVPRRRL HAPARRLYGR VHARRDQSAR ADDRHPHAVL IRRAGRPADA       480
     SAVPPFALPA PPACSVFPAF FAAPARSPAR RGVRRPGSCR AFCLPRPFVD EPRGTPSNSA       540
     AP                                                                      542
//

If you have problems or comments...

PBIL Back to PBIL home page