(data stored in SCRATCH9089 zone)

EMBL: CP000124.PE25

CP000124.PE25        Location/Qualifiers
FT   CDS             complement(35368..37179)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_0030"
FT                   /product="dehydrogenase"
FT                   /note="identified by match to protein family HMM PF02826;
FT                   match to protein family HMM PF03446; match to protein
FT                   family HMM PF03807"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0030"
FT                   /db_xref="EnsemblGenomes-Tr:ABA49487"
FT                   /db_xref="GOA:Q3JYA5"
FT                   /db_xref="InterPro:IPR006115"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR029154"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JYA5"
FT                   /protein_id="ABA49487.1"
FT                   /translation="MRLRCASDACRCTRDASVRASARRRLRLRHVLDQRAHAPPVRAFP
FT                   EHAAAYVAGDEARVTLQHALRRAAGSLGGIDAPQRRIARQAQPERPRAAGEVEPIEQLL
FT                   QLRLRLQRAHVAAVRDRAALEQFAIAREDDSRFARGDRLDQLVRVVVVVQRVEAGEPQQ
FT                   LREPAEVRIGDEARDAQRRGAHAQQRADVDRLEARVDGDAVAFFEHVAERCRFAVDEDQ
FT                   LDFGMRHAERFDRMLDARAAHARVREFATAQRPREEIVQLLVEAESHGDHRLSIAPPRA
FT                   CRTSRDARRETANVARLCFTRAFDGLDEYKEHDMDIGFIGAGEMGSAIAGNLLKAGHRV
FT                   RVWNRSAERVAPLVALGAQQVATVADAFAGDAVFSMLADDAAARDVFDAALLEQAPRGL
FT                   IHVNMATISVALAEQLAHAHAQRAIHYVAAPVMGRPHVAAAARLTIIAAGPAEAIDRMQ
FT                   PAFDAIGQRTWRLGSLPQHANAVKIAANFTIASAIETMGEAGALLAAHGVAMNDYLDVI
FT                   TNSVFPGPVYQGYGAMIAESRYEPALFKARLGLKDVRLALEAGDALSVPLPVASVVRDS
FT                   LIEAVAHGHGDKDFAVLGQVAARRAGR"
     MRLRCASDAC RCTRDASVRA SARRRLRLRH VLDQRAHAPP VRAFPEHAAA YVAGDEARVT        60
     LQHALRRAAG SLGGIDAPQR RIARQAQPER PRAAGEVEPI EQLLQLRLRL QRAHVAAVRD       120
     RAALEQFAIA REDDSRFARG DRLDQLVRVV VVVQRVEAGE PQQLREPAEV RIGDEARDAQ       180
     RRGAHAQQRA DVDRLEARVD GDAVAFFEHV AERCRFAVDE DQLDFGMRHA ERFDRMLDAR       240
     AAHARVREFA TAQRPREEIV QLLVEAESHG DHRLSIAPPR ACRTSRDARR ETANVARLCF       300
     TRAFDGLDEY KEHDMDIGFI GAGEMGSAIA GNLLKAGHRV RVWNRSAERV APLVALGAQQ       360
     VATVADAFAG DAVFSMLADD AAARDVFDAA LLEQAPRGLI HVNMATISVA LAEQLAHAHA       420
     QRAIHYVAAP VMGRPHVAAA ARLTIIAAGP AEAIDRMQPA FDAIGQRTWR LGSLPQHANA       480
     VKIAANFTIA SAIETMGEAG ALLAAHGVAM NDYLDVITNS VFPGPVYQGY GAMIAESRYE       540
     PALFKARLGL KDVRLALEAG DALSVPLPVA SVVRDSLIEA VAHGHGDKDF AVLGQVAARR       600
     AGR                                                                     603
//

If you have problems or comments...

PBIL Back to PBIL home page