(data stored in SCRATCH9089 zone)

EMBL: CP000124.PE254

CP000124.PE254       Location/Qualifiers
FT   CDS             270359..271816
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_0262"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0262"
FT                   /db_xref="EnsemblGenomes-Tr:ABA49855"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JXM6"
FT                   /protein_id="ABA49855.1"
FT                   /translation="MFVRRRERCAPHAAPHSEPEIDGGAPSAAAHNDNPNGDDDEEVCG
FT                   SGGGPCRRDGRARVRRQRHAVRPDRCRRVVRVERRRQAQRVFRRRHRGAESMGASGHRG
FT                   SRRRREGDLRADVAIRARQRRRAADAGLDVLAHRARRPLERAARQRDARPAIRLHDRFA
FT                   DVRLVRRCVPLRRSVQLPPGAVLEARDSRQSHRLVRLRPVGGFEPRAELGQVHEREPER
FT                   ARVRPDVRFRQSGGRRARGEQHRQRRPQVRDGQFRARRRLRRSQVSADEQRARRAAQLG
FT                   ARRALCTVRVRSEPAVHEHAQHADGRGDRRDPGRRALRRRAVDDRRELRVHEGQRAARS
FT                   QLRASSHGGRAVCAVQAHVRVRRDRVPVRGRQRGRACVDQRRDGARCAVELAFAVSRAN
FT                   RHAYPFLTVSRPRRPPRAVRLRGSGRAARAPGRPEFAGCAGLARGGFRTRRHGRASRAG
FT                   ARACVFGQVAAGACIARRTAPCVGWRT"
     MFVRRRERCA PHAAPHSEPE IDGGAPSAAA HNDNPNGDDD EEVCGSGGGP CRRDGRARVR        60
     RQRHAVRPDR CRRVVRVERR RQAQRVFRRR HRGAESMGAS GHRGSRRRRE GDLRADVAIR       120
     ARQRRRAADA GLDVLAHRAR RPLERAARQR DARPAIRLHD RFADVRLVRR CVPLRRSVQL       180
     PPGAVLEARD SRQSHRLVRL RPVGGFEPRA ELGQVHEREP ERARVRPDVR FRQSGGRRAR       240
     GEQHRQRRPQ VRDGQFRARR RLRRSQVSAD EQRARRAAQL GARRALCTVR VRSEPAVHEH       300
     AQHADGRGDR RDPGRRALRR RAVDDRRELR VHEGQRAARS QLRASSHGGR AVCAVQAHVR       360
     VRRDRVPVRG RQRGRACVDQ RRDGARCAVE LAFAVSRANR HAYPFLTVSR PRRPPRAVRL       420
     RGSGRAARAP GRPEFAGCAG LARGGFRTRR HGRASRAGAR ACVFGQVAAG ACIARRTAPC       480
     VGWRT                                                                   485
//

If you have problems or comments...

PBIL Back to PBIL home page