(data stored in SCRATCH9089 zone)

EMBL: CP000124.PE257

CP000124.PE257       Location/Qualifiers
FT   CDS             complement(273059..273790)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="livF"
FT                   /locus_tag="BURPS1710b_0264"
FT                   /product="ABC transport system ATP-binding protein"
FT                   /note="identified by match to protein family HMM PF00005"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0264"
FT                   /db_xref="EnsemblGenomes-Tr:ABA48211"
FT                   /db_xref="GOA:Q3JXM3"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JXM3"
FT                   /protein_id="ABA48211.1"
FT                   /translation="MQLEVKNLVVHRANKPVLHGVSLAVTPGRVTALVGANGAGKSTLV
FT                   MSIAGALPATSGNVLLGGAPLGALRPEAVRRLGVAVVPEGHHVLGDLTVRDNLRAAGAF
FT                   LSARRLNGAIDRALAIFPELEPKLDARANDLSGGQKQMVCVSQALIGEPHTLLIDELSL
FT                   GLAPTVTKRLAQTVARIANDGVAVLLIEQFTTIALALATNAYVLERGRVAFAGSAQTLR
FT                   ERPEILHGSYLASKGSGANAA"
     MQLEVKNLVV HRANKPVLHG VSLAVTPGRV TALVGANGAG KSTLVMSIAG ALPATSGNVL        60
     LGGAPLGALR PEAVRRLGVA VVPEGHHVLG DLTVRDNLRA AGAFLSARRL NGAIDRALAI       120
     FPELEPKLDA RANDLSGGQK QMVCVSQALI GEPHTLLIDE LSLGLAPTVT KRLAQTVARI       180
     ANDGVAVLLI EQFTTIALAL ATNAYVLERG RVAFAGSAQT LRERPEILHG SYLASKGSGA       240
     NAA                                                                     243
//

If you have problems or comments...

PBIL Back to PBIL home page