(data stored in SCRATCH9089 zone)

EMBL: CP000124.PE26

CP000124.PE26        Location/Qualifiers
FT   CDS             36364..37119
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_0031"
FT                   /product="Protein of unknown function family"
FT                   /note="identified by match to protein family HMM PF01927"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0031"
FT                   /db_xref="EnsemblGenomes-Tr:ABA50279"
FT                   /db_xref="InterPro:IPR002782"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR016155"
FT                   /db_xref="InterPro:IPR027798"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JYA4"
FT                   /protein_id="ABA50279.1"
FT                   /translation="MVTVTFRFYEELNDFLARPLRRREFAHACMRGASVKHAIEALGVP
FT                   HTEVELILVNGESTPFSHVLEEGDRVAVYPSFEAIDIRPLLRVRAAPLRVTRFIADAHL
FT                   GGLAQLLRLAGFDTLYDNHYPDELIETIAAREARIVLTRDRELLKRRTITHGCYVRALK
FT                   PQAQLQELFDRLDLAGSARPFRLCLSCNAPLRRIDPAEAAGRAPQGVLQRHTRFVTCDV
FT                   CRRVFWEGSHWRRMRALIEHVSQPKPPPG"
     MVTVTFRFYE ELNDFLARPL RRREFAHACM RGASVKHAIE ALGVPHTEVE LILVNGESTP        60
     FSHVLEEGDR VAVYPSFEAI DIRPLLRVRA APLRVTRFIA DAHLGGLAQL LRLAGFDTLY       120
     DNHYPDELIE TIAAREARIV LTRDRELLKR RTITHGCYVR ALKPQAQLQE LFDRLDLAGS       180
     ARPFRLCLSC NAPLRRIDPA EAAGRAPQGV LQRHTRFVTC DVCRRVFWEG SHWRRMRALI       240
     EHVSQPKPPP G                                                            251
//

If you have problems or comments...

PBIL Back to PBIL home page