(data stored in SCRATCH9089 zone)

EMBL: CP000124.PE260

CP000124.PE260       Location/Qualifiers
FT   CDS             complement(274882..275931)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_0267"
FT                   /product="branched chain amino acid ABC transporter,
FT                   ATP-binding/permease protein"
FT                   /note="identified by match to protein family HMM PF02653"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0267"
FT                   /db_xref="EnsemblGenomes-Tr:ABA48755"
FT                   /db_xref="GOA:Q3JXM0"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JXM0"
FT                   /protein_id="ABA48755.1"
FT                   /translation="MKTPLAFAAPPRDAAARAKPAGARLALVATLGTLAAIALVVPAVA
FT                   DAYWIKTLTSALTVSIAAAGVALLYRQLGLVCLSQHALFGVGGWIALRLAHLGAPFELC
FT                   VLAGAAGGSAIGMIAGLPALRLRGLYLALVTLMMAGGFQVVVSAIGFPDGGGGFTGHLS
FT                   FGARQMMARPLVGQSDAAYFRYVAAWAALAFALIELHRRSKAGRSWALIRRGEMPALAA
FT                   GVNVVLYQTWAFGLAGLLAGLSGGLLAGSVGQLDGRAFAASESVLLFALSVVGGVYHWF
FT                   GALITGLLLRAVPALLTDFGVNGYLAMIFFGAALLHALVTAPAGIAGQLAGLASRVGRA
FT                   FRARDGGAR"
     MKTPLAFAAP PRDAAARAKP AGARLALVAT LGTLAAIALV VPAVADAYWI KTLTSALTVS        60
     IAAAGVALLY RQLGLVCLSQ HALFGVGGWI ALRLAHLGAP FELCVLAGAA GGSAIGMIAG       120
     LPALRLRGLY LALVTLMMAG GFQVVVSAIG FPDGGGGFTG HLSFGARQMM ARPLVGQSDA       180
     AYFRYVAAWA ALAFALIELH RRSKAGRSWA LIRRGEMPAL AAGVNVVLYQ TWAFGLAGLL       240
     AGLSGGLLAG SVGQLDGRAF AASESVLLFA LSVVGGVYHW FGALITGLLL RAVPALLTDF       300
     GVNGYLAMIF FGAALLHALV TAPAGIAGQL AGLASRVGRA FRARDGGAR                   349
//

If you have problems or comments...

PBIL Back to PBIL home page