(data stored in SCRATCH9089 zone)

EMBL: CP000124.PE265

CP000124.PE265       Location/Qualifiers
FT   CDS             complement(278287..279792)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_0272"
FT                   /product="phenylacetaldehyde dehydrogenase"
FT                   /EC_number="1.2.1.39"
FT                   /note="identified by match to protein family HMM PF00171"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0272"
FT                   /db_xref="EnsemblGenomes-Tr:ABA47982"
FT                   /db_xref="GOA:Q3JXL5"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016160"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="InterPro:IPR029510"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JXL5"
FT                   /protein_id="ABA47982.1"
FT                   /translation="MNLAALSTQHQRQSGFLARRQFGNWIDGRAAEPRSGRYLPVVDPA
FT                   TEMTIAEVAASDARDVDAAVAAARRAFDSGDWPRMRPASREKLLHQLAERLERYADELA
FT                   ALETLETGKLIGVARAIDVLGGAEYVRYMAGWATKLEGSTLDTSIAAPAGAEYFAYTRR
FT                   EAVGVVGAIVPWNFPLAIALWKVATALACGCTVVLKPSEETPLTALRLGELAQEAGLPD
FT                   GVLNIVTGAGAEAGAALAAHPGIDKITFTGSVGVGRAIGHAAVERMARFTLELGGKSPL
FT                   IVLDDADPDFAAHGAAQGIFFNQGQVCTAGSRVYVQKRLFERVVAGIAAAAEAMKIGSG
FT                   FDPNTQIGPLVSKRHFERVLGHVGAAKEEGATLVTGGTRALDGGYFVKPTVFVDAAPAM
FT                   RIVREEVFGPVVTVTPFDTVDDAVRLANDTDFGLAASVWSQNLSHVHRVVPRLKAGIVW
FT                   VNTHNMLDPNLPFGGFKQSGYGRELGRAALEQFTELKSVCIAH"
     MNLAALSTQH QRQSGFLARR QFGNWIDGRA AEPRSGRYLP VVDPATEMTI AEVAASDARD        60
     VDAAVAAARR AFDSGDWPRM RPASREKLLH QLAERLERYA DELAALETLE TGKLIGVARA       120
     IDVLGGAEYV RYMAGWATKL EGSTLDTSIA APAGAEYFAY TRREAVGVVG AIVPWNFPLA       180
     IALWKVATAL ACGCTVVLKP SEETPLTALR LGELAQEAGL PDGVLNIVTG AGAEAGAALA       240
     AHPGIDKITF TGSVGVGRAI GHAAVERMAR FTLELGGKSP LIVLDDADPD FAAHGAAQGI       300
     FFNQGQVCTA GSRVYVQKRL FERVVAGIAA AAEAMKIGSG FDPNTQIGPL VSKRHFERVL       360
     GHVGAAKEEG ATLVTGGTRA LDGGYFVKPT VFVDAAPAMR IVREEVFGPV VTVTPFDTVD       420
     DAVRLANDTD FGLAASVWSQ NLSHVHRVVP RLKAGIVWVN THNMLDPNLP FGGFKQSGYG       480
     RELGRAALEQ FTELKSVCIA H                                                 501
//

If you have problems or comments...

PBIL Back to PBIL home page