(data stored in SCRATCH9089 zone)

EMBL: CP000124.PE266

CP000124.PE266       Location/Qualifiers
FT   CDS             complement(279848..280267)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_0273"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0273"
FT                   /db_xref="EnsemblGenomes-Tr:ABA49802"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="InterPro:IPR037401"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JXL4"
FT                   /protein_id="ABA49802.1"
FT                   /translation="MRNRSEDHTMRTPYQIVADHYAASDRRDPAAMMADIAPTIEWTEM
FT                   AGFPCAGTYRSADEIVRNVFRRLGEEWDGYTFALDALHDAGDTVIGIGRYSGTYRRTGK
FT                   SFACRVAHVWRVDAGKIVRFEQFTDTLLVAQAMQP"
     MRNRSEDHTM RTPYQIVADH YAASDRRDPA AMMADIAPTI EWTEMAGFPC AGTYRSADEI        60
     VRNVFRRLGE EWDGYTFALD ALHDAGDTVI GIGRYSGTYR RTGKSFACRV AHVWRVDAGK       120
     IVRFEQFTDT LLVAQAMQP                                                    139
//

If you have problems or comments...

PBIL Back to PBIL home page