(data stored in SCRATCH9089 zone)

EMBL: CP000124.PE267

CP000124.PE267       Location/Qualifiers
FT   CDS             complement(280171..281595)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_0275"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0275"
FT                   /db_xref="EnsemblGenomes-Tr:ABA50400"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JXL3"
FT                   /protein_id="ABA50400.1"
FT                   /translation="MGAIDAREPRHRVRLRARVAARADRAARQHRDPVVARRPFRGAER
FT                   HRLRDDQARADRPHTLARARLRPCRRARERGVPGLGAHRDGRRADGRAARRARARDARG
FT                   RLPARHARRAARPPGAARRSRRHGAVPGVAVCIDGHGHVAARRRRRIRRRSADDRIRAL
FT                   MPGATAPDELFRGLTDERQTAGLEELRRLRGRHRHEPAARDRCARRPRADVRAAGRRVR
FT                   REFRRRPDALVATRRDRRHRLVRGDRSRARYVLRRRHVQEPAGRGADARVQHRDAARAR
FT                   HPVAHPQPRRSGRRAARRAGFPRRHDRRRPSRCGCIGHIGHSGRRARRDARSDRHAHAE
FT                   RLQPEPHVRAHVPELGALLLAMPRRRAARPRRRRSRDDLQVRRRSLRVHVPRVPDSGRV
FT                   GVRVQLRGRPLDRQVSRRDGRRRDREPAGRLLHPQTVAGRLSGRCATDLRTIRCVPLTK
FT                   SSPIITRRPTGAIPPR"
     MGAIDAREPR HRVRLRARVA ARADRAARQH RDPVVARRPF RGAERHRLRD DQARADRPHT        60
     LARARLRPCR RARERGVPGL GAHRDGRRAD GRAARRARAR DARGRLPARH ARRAARPPGA       120
     ARRSRRHGAV PGVAVCIDGH GHVAARRRRR IRRRSADDRI RALMPGATAP DELFRGLTDE       180
     RQTAGLEELR RLRGRHRHEP AARDRCARRP RADVRAAGRR VRREFRRRPD ALVATRRDRR       240
     HRLVRGDRSR ARYVLRRRHV QEPAGRGADA RVQHRDAARA RHPVAHPQPR RSGRRAARRA       300
     GFPRRHDRRR PSRCGCIGHI GHSGRRARRD ARSDRHAHAE RLQPEPHVRA HVPELGALLL       360
     AMPRRRAARP RRRRSRDDLQ VRRRSLRVHV PRVPDSGRVG VRVQLRGRPL DRQVSRRDGR       420
     RRDREPAGRL LHPQTVAGRL SGRCATDLRT IRCVPLTKSS PIITRRPTGA IPPR             474
//

If you have problems or comments...

PBIL Back to PBIL home page