(data stored in SCRATCH9089 zone)

EMBL: CP000124.PE272

CP000124.PE272       Location/Qualifiers
FT   CDS             284385..284726
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_0279"
FT                   /product="PadR-like family transcriptional regulator"
FT                   /note="identified by match to protein family HMM PF03551"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0279"
FT                   /db_xref="EnsemblGenomes-Tr:ABA49170"
FT                   /db_xref="InterPro:IPR005149"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JXK8"
FT                   /protein_id="ABA49170.1"
FT                   /translation="MKTQLKKGALDMCVLAMLARRDSYAYELVSTLAETMEISEGTIYP
FT                   LMRRLQAEAWVTTYLVESTSGPPRKYYSITDAGRASLRQMEDEWRSFVDEVNGVLALHG
FT                   TRADGEERQ"
     MKTQLKKGAL DMCVLAMLAR RDSYAYELVS TLAETMEISE GTIYPLMRRL QAEAWVTTYL        60
     VESTSGPPRK YYSITDAGRA SLRQMEDEWR SFVDEVNGVL ALHGTRADGE ERQ              113
//

If you have problems or comments...

PBIL Back to PBIL home page