(data stored in SCRATCH9089 zone)

EMBL: CP000124.PE277

CP000124.PE277       Location/Qualifiers
FT   CDS             complement(288875..289876)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_0284"
FT                   /product="AraC family transcriptional regulator"
FT                   /note="identified by match to protein family HMM PF00165;
FT                   match to protein family HMM PF01965"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0284"
FT                   /db_xref="EnsemblGenomes-Tr:ABA48669"
FT                   /db_xref="GOA:Q3JXK3"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JXK3"
FT                   /protein_id="ABA48669.1"
FT                   /translation="MKARSLDVVNSRLFDIAILSHDGRPVPTIGGLDVPATAALSDADA
FT                   HEVVIVPAQFMPDAQIGALERVFIDWLERRYAAGALVVGLNAAPLLAKAGLLDGRGATG
FT                   LPSERTLFARHFPAVRYTPSKPLVVDGRLITVSGINPAVDACAYVIDYCFGAGVSQRLL
FT                   RVALTQSLPSYEHMAVWAAQYKRHGDAPVLAVQDSVERALAHPPTLAELAARAAMSERT
FT                   LSRRFAAATGLTLRRYVAALRVELAAFLLRTSRMTLEHIADECGFASASALSHAFLAGQ
FT                   GCSPIQYRNRHRPDARPDARREPAGGGGTGGTGGTAAGSGEGAASSGGRAGK"
     MKARSLDVVN SRLFDIAILS HDGRPVPTIG GLDVPATAAL SDADAHEVVI VPAQFMPDAQ        60
     IGALERVFID WLERRYAAGA LVVGLNAAPL LAKAGLLDGR GATGLPSERT LFARHFPAVR       120
     YTPSKPLVVD GRLITVSGIN PAVDACAYVI DYCFGAGVSQ RLLRVALTQS LPSYEHMAVW       180
     AAQYKRHGDA PVLAVQDSVE RALAHPPTLA ELAARAAMSE RTLSRRFAAA TGLTLRRYVA       240
     ALRVELAAFL LRTSRMTLEH IADECGFASA SALSHAFLAG QGCSPIQYRN RHRPDARPDA       300
     RREPAGGGGT GGTGGTAAGS GEGAASSGGR AGK                                    333
//

If you have problems or comments...

PBIL Back to PBIL home page