(data stored in SCRATCH9089 zone)

EMBL: CP000124.PE279

CP000124.PE279       Location/Qualifiers
FT   CDS             291257..293110
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_0286"
FT                   /product="beta-ketoadipyl CoA thiolase"
FT                   /EC_number="2.3.1.-"
FT                   /note="identified by match to protein family HMM PF00108;
FT                   match to protein family HMM PF02803; match to protein
FT                   family HMM TIGR01930"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0286"
FT                   /db_xref="EnsemblGenomes-Tr:ABA47799"
FT                   /db_xref="GOA:Q3JXK1"
FT                   /db_xref="InterPro:IPR002155"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="InterPro:IPR020610"
FT                   /db_xref="InterPro:IPR020613"
FT                   /db_xref="InterPro:IPR020616"
FT                   /db_xref="InterPro:IPR020617"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JXK1"
FT                   /protein_id="ABA47799.1"
FT                   /translation="MGDAARLGRASRFERGRRRDRRERFARGARSGGAIRVRAAWHGVA
FT                   WHGVALQPDAVRPPRSARAFARHANRLGERAAVRGVAPCVARGIGAAPSGRPNRTAACA
FT                   ELAPTPSGLSSRVCVRDRARHHEDAPGERAAGGRLGKWCRAGGRTGKARRKHAGKRRSA
FT                   RPSGATGRTRRTSRRPAERRGLSRSAAAAAVRPGWPSRLAVPTGHLHQPKERFMEAYIF
FT                   DAVRTPRGKGKKDGSLHGVTPLALAATALRAIRDRNGLDTRAVDDVVLGCVEPVGEQGA
FT                   CIGRIAVLAAGYAETTAGVQINRFCASGLEACNMAAAQVMSGQSEMAIGGGVESMSRVP
FT                   MGSSGGAWPVDPAIAIPSYFVPQGVSADTIATKWGYSRADVDAYAAESHRRAHAAAQAG
FT                   WFARSIVPVRDANGLTILDHDETIRPQTTPETLATLKPSFAELGEMYGFDAVIRQRYPE
FT                   LERIEHVHHAGNSSGIVDGASAVLIGSLEAGKRAGLAPRARIRSFASIGSEPSIMLTGP
FT                   AYAAQKALERAGMRAADIDLYELNEAFASVVLRFMDAMAIAHDRINVNGGAIAMGHPLG
FT                   ATGAMILGTLLDELERRGAATGLATLCVGAGMGTATIIERI"
     MGDAARLGRA SRFERGRRRD RRERFARGAR SGGAIRVRAA WHGVAWHGVA LQPDAVRPPR        60
     SARAFARHAN RLGERAAVRG VAPCVARGIG AAPSGRPNRT AACAELAPTP SGLSSRVCVR       120
     DRARHHEDAP GERAAGGRLG KWCRAGGRTG KARRKHAGKR RSARPSGATG RTRRTSRRPA       180
     ERRGLSRSAA AAAVRPGWPS RLAVPTGHLH QPKERFMEAY IFDAVRTPRG KGKKDGSLHG       240
     VTPLALAATA LRAIRDRNGL DTRAVDDVVL GCVEPVGEQG ACIGRIAVLA AGYAETTAGV       300
     QINRFCASGL EACNMAAAQV MSGQSEMAIG GGVESMSRVP MGSSGGAWPV DPAIAIPSYF       360
     VPQGVSADTI ATKWGYSRAD VDAYAAESHR RAHAAAQAGW FARSIVPVRD ANGLTILDHD       420
     ETIRPQTTPE TLATLKPSFA ELGEMYGFDA VIRQRYPELE RIEHVHHAGN SSGIVDGASA       480
     VLIGSLEAGK RAGLAPRARI RSFASIGSEP SIMLTGPAYA AQKALERAGM RAADIDLYEL       540
     NEAFASVVLR FMDAMAIAHD RINVNGGAIA MGHPLGATGA MILGTLLDEL ERRGAATGLA       600
     TLCVGAGMGT ATIIERI                                                      617
//

If you have problems or comments...

PBIL Back to PBIL home page