(data stored in SCRATCH9089 zone)

EMBL: CP000124.PE299

CP000124.PE299       Location/Qualifiers
FT   CDS             complement(315493..315954)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_0306"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0306"
FT                   /db_xref="EnsemblGenomes-Tr:ABA47755"
FT                   /db_xref="GOA:Q3JXI1"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JXI1"
FT                   /protein_id="ABA47755.1"
FT                   /translation="MVVFLAAVELHNLAMPTHEEKAAFTERLKFALLRSPEKVTGATEL
FT                   ALHFNLRHHGEHPVSPQTAHKWLTGRTIPTPDKLHTLAEWLRVDLHWLHYGPPPSAART
FT                   TPQPLPRDEKYPPTPETIELASKIEALSPHHRYLVQELIEQFYGDTSKR"
     MVVFLAAVEL HNLAMPTHEE KAAFTERLKF ALLRSPEKVT GATELALHFN LRHHGEHPVS        60
     PQTAHKWLTG RTIPTPDKLH TLAEWLRVDL HWLHYGPPPS AARTTPQPLP RDEKYPPTPE       120
     TIELASKIEA LSPHHRYLVQ ELIEQFYGDT SKR                                    153
//

If you have problems or comments...

PBIL Back to PBIL home page