(data stored in SCRATCH9089 zone)

EMBL: CP000124.PE302

CP000124.PE302       Location/Qualifiers
FT   CDS             complement(319699..322566)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_0309"
FT                   /product="inner membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0309"
FT                   /db_xref="EnsemblGenomes-Tr:ABA49691"
FT                   /db_xref="GOA:Q3JXH8"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR009270"
FT                   /db_xref="InterPro:IPR014819"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JXH8"
FT                   /protein_id="ABA49691.1"
FT                   /translation="MSNAPMSEFERASVALGYVPADDRDTWRQAGMALKAEFGEEGFTL
FT                   WNEWSQGAQNYNARDARDVWKSFKGGKITINTLFHLAKQGGFDPRAHRAKPVDPAERER
FT                   QKAERAAREAAELVELIEKQQAASALAESIWSAAEPAPAGHPYLVRKRIPADALRVYRG
FT                   NLSIGTAACDSALVIPARDADGTLRTLEFILTDGQKRYLPNGRKAGCFSLIGDAVSSVL
FT                   LIGEGYATCATLAAATGYPVAVAFDTGNLHAVATALRGQYPDARIVVCADDDHTTNGNP
FT                   GVTKARAAADAVGGAVTVPDFGPNRPAAGTDFNDLAAHLGPDAVVVAVRAALTSAGSSD
FT                   ADRGKARSPVEKPAKRPKTARAQDGKSRFVVDDKGVWFHGFNNQGDPLPPHWVSTRIDV
FT                   IAETRNEMNSEWGYLLEFTDRDGILKRWAVPAGLFAGDGTELRRMLLDMGVKLGVTQIA
FT                   RTQIANYVQMAQPDERVRCVPRVGWHHGAFVLPDRVIGTGKEALIYQADTPIQSQFKER
FT                   GTLDDWQREVAAYCVGNSRLLFCVATAFAGPLLHFSGLQSGGFHLLGTTSKGKSTGGVI
FT                   AASVFGSPDYVRSWKATDNALEAVATQHSDALLILDEIGQVEPRLVGDVIYMLANESGK
FT                   ARASRSGSAKPVLTWRLLFLSNGEKSVSALMAEGNKPMKGGIEVRLPAIPAEVGEMGVV
FT                   EKLHGFPTPAALIEHLERHAGIHYGTAGPAFIEWASSQAGELAEHLRIRVDELVGQWVP
FT                   DGSHSQVARVAKRFCLVAVAGELATAHGLTGWPQGEAVEAARRCFEGWLELRGGTGNSD
FT                   EAEAVRQVQHFLAAHGDNRFVWMNRAQDDHRPNVPHRAGFKQHVKRDERRTPIASDREY
FT                   YAEFGGKMSADDAESVETEYLIEAAVFRKDVCAGFDHKIVAKALMKRGVLMPRSDGYPY
FT                   RHEYIPGHGKFMVYRVLPSIFTLEL"
     MSNAPMSEFE RASVALGYVP ADDRDTWRQA GMALKAEFGE EGFTLWNEWS QGAQNYNARD        60
     ARDVWKSFKG GKITINTLFH LAKQGGFDPR AHRAKPVDPA ERERQKAERA AREAAELVEL       120
     IEKQQAASAL AESIWSAAEP APAGHPYLVR KRIPADALRV YRGNLSIGTA ACDSALVIPA       180
     RDADGTLRTL EFILTDGQKR YLPNGRKAGC FSLIGDAVSS VLLIGEGYAT CATLAAATGY       240
     PVAVAFDTGN LHAVATALRG QYPDARIVVC ADDDHTTNGN PGVTKARAAA DAVGGAVTVP       300
     DFGPNRPAAG TDFNDLAAHL GPDAVVVAVR AALTSAGSSD ADRGKARSPV EKPAKRPKTA       360
     RAQDGKSRFV VDDKGVWFHG FNNQGDPLPP HWVSTRIDVI AETRNEMNSE WGYLLEFTDR       420
     DGILKRWAVP AGLFAGDGTE LRRMLLDMGV KLGVTQIART QIANYVQMAQ PDERVRCVPR       480
     VGWHHGAFVL PDRVIGTGKE ALIYQADTPI QSQFKERGTL DDWQREVAAY CVGNSRLLFC       540
     VATAFAGPLL HFSGLQSGGF HLLGTTSKGK STGGVIAASV FGSPDYVRSW KATDNALEAV       600
     ATQHSDALLI LDEIGQVEPR LVGDVIYMLA NESGKARASR SGSAKPVLTW RLLFLSNGEK       660
     SVSALMAEGN KPMKGGIEVR LPAIPAEVGE MGVVEKLHGF PTPAALIEHL ERHAGIHYGT       720
     AGPAFIEWAS SQAGELAEHL RIRVDELVGQ WVPDGSHSQV ARVAKRFCLV AVAGELATAH       780
     GLTGWPQGEA VEAARRCFEG WLELRGGTGN SDEAEAVRQV QHFLAAHGDN RFVWMNRAQD       840
     DHRPNVPHRA GFKQHVKRDE RRTPIASDRE YYAEFGGKMS ADDAESVETE YLIEAAVFRK       900
     DVCAGFDHKI VAKALMKRGV LMPRSDGYPY RHEYIPGHGK FMVYRVLPSI FTLEL            955
//

If you have problems or comments...

PBIL Back to PBIL home page