(data stored in SCRATCH9089 zone)

EMBL: CP000124.PE312

CP000124.PE312       Location/Qualifiers
FT   CDS             complement(333973..335478)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_0320"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0320"
FT                   /db_xref="EnsemblGenomes-Tr:ABA50179"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JXG8"
FT                   /protein_id="ABA50179.1"
FT                   /translation="MHRPAARRTDRLHSVGLPLEGDVPDEIPHPRDRSRGAARRRSGGD
FT                   DPFLLRRAGLPRRKRAAGTGARSIARRTLADRSARGWRADRSGRQRSAGKGTEHGSSVP
FT                   ARRAVRCGRAAHAPRRTWRAARRRGAALRRGRLWAVALPVRSGRQHGRTEGAAGSRRAL
FT                   KAHAGEPATGLTAANVGSRESGVGSRESGVGSRKSEVGSRGAGSRADEKARRAGRHPAA
FT                   ERRPAARAPSGVFARLQRRPLDRDRIMRRARQPGGAILDRALQTHRALGEAAERRRDAV
FT                   GERRHLHVAQPLDLAARALPPDVGRASAVRDHVHAAGSAACLRDTALVGLPDVDPYLDR
FT                   PRQVFLPKIGLVGIRQPLAELEPLVREQRERGDTHHHPLVRFGRVTGDGERVIGIVVPI
FT                   HVGDLQLRLVDRRFERHSASQPARAVDSVRGVMIPNARCARDVARNCRRRRQRAAAVNA
FT                   RRPDARRAVRFRRGPAFRGPGRDSAGERPRYCLMKRASVQRPC"
     MHRPAARRTD RLHSVGLPLE GDVPDEIPHP RDRSRGAARR RSGGDDPFLL RRAGLPRRKR        60
     AAGTGARSIA RRTLADRSAR GWRADRSGRQ RSAGKGTEHG SSVPARRAVR CGRAAHAPRR       120
     TWRAARRRGA ALRRGRLWAV ALPVRSGRQH GRTEGAAGSR RALKAHAGEP ATGLTAANVG       180
     SRESGVGSRE SGVGSRKSEV GSRGAGSRAD EKARRAGRHP AAERRPAARA PSGVFARLQR       240
     RPLDRDRIMR RARQPGGAIL DRALQTHRAL GEAAERRRDA VGERRHLHVA QPLDLAARAL       300
     PPDVGRASAV RDHVHAAGSA ACLRDTALVG LPDVDPYLDR PRQVFLPKIG LVGIRQPLAE       360
     LEPLVREQRE RGDTHHHPLV RFGRVTGDGE RVIGIVVPIH VGDLQLRLVD RRFERHSASQ       420
     PARAVDSVRG VMIPNARCAR DVARNCRRRR QRAAAVNARR PDARRAVRFR RGPAFRGPGR       480
     DSAGERPRYC LMKRASVQRP C                                                 501
//

If you have problems or comments...

PBIL Back to PBIL home page