(data stored in SCRATCH9089 zone)

EMBL: CP000124.PE315

CP000124.PE315       Location/Qualifiers
FT   CDS             335807..336901
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_0322"
FT                   /product="O6-methylguanine-DNA methyltransferase"
FT                   /EC_number="2.1.1.63"
FT                   /note="identified by match to protein family HMM PF00165;
FT                   match to protein family HMM PF01035; match to protein
FT                   family HMM PF02805; match to protein family HMM PF02870;
FT                   match to protein family HMM TIGR00589"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0322"
FT                   /db_xref="EnsemblGenomes-Tr:ABA50624"
FT                   /db_xref="GOA:Q3JXG5"
FT                   /db_xref="InterPro:IPR001497"
FT                   /db_xref="InterPro:IPR004026"
FT                   /db_xref="InterPro:IPR008332"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR014048"
FT                   /db_xref="InterPro:IPR016221"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR023546"
FT                   /db_xref="InterPro:IPR035451"
FT                   /db_xref="InterPro:IPR036217"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036631"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JXG5"
FT                   /protein_id="ABA50624.1"
FT                   /translation="MKQPPYPTDDARWAALVARDVDADGAFCYAVKTTGVFCRPSCASR
FT                   LPRRENVSFFADTGAARAAGYRPCKRCRPEGLPRELDIVNRACAVLDAHRQDRFTLAQL
FT                   SDAVHVSPFHLQRLFKRVVGVSPRQYQAAQRGAALRDALQSGAAVTRAAVDAGFNSPSR
FT                   LYESVPRELGMSPSAFRRKGAGLKIDYATADTRLGVVLVAATSKGICKIAFGDAAAPLV
FT                   DELRTGFANAQIAESPERIAPFIAQVDAYLNGTRRRFELPLDLAATEFQQRVWDALRRI
FT                   PYGETRSYTQIAEALGAPRAVRAVASACASNPVALAIPCHRVVQKGGSLAGYRWGLPRK
FT                   AALLDAEARRAAGESVESAVDHAA"
     MKQPPYPTDD ARWAALVARD VDADGAFCYA VKTTGVFCRP SCASRLPRRE NVSFFADTGA        60
     ARAAGYRPCK RCRPEGLPRE LDIVNRACAV LDAHRQDRFT LAQLSDAVHV SPFHLQRLFK       120
     RVVGVSPRQY QAAQRGAALR DALQSGAAVT RAAVDAGFNS PSRLYESVPR ELGMSPSAFR       180
     RKGAGLKIDY ATADTRLGVV LVAATSKGIC KIAFGDAAAP LVDELRTGFA NAQIAESPER       240
     IAPFIAQVDA YLNGTRRRFE LPLDLAATEF QQRVWDALRR IPYGETRSYT QIAEALGAPR       300
     AVRAVASACA SNPVALAIPC HRVVQKGGSL AGYRWGLPRK AALLDAEARR AAGESVESAV       360
     DHAA                                                                    364
//

If you have problems or comments...

PBIL Back to PBIL home page