(data stored in SCRATCH9089 zone)

EMBL: CP000124.PE32

CP000124.PE32        Location/Qualifiers
FT   CDS             complement(42713..43399)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_0038"
FT                   /product="cytochrome c family protein"
FT                   /note="identified by match to protein family HMM PF00034"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0038"
FT                   /db_xref="EnsemblGenomes-Tr:ABA50989"
FT                   /db_xref="GOA:Q3JY98"
FT                   /db_xref="InterPro:IPR002324"
FT                   /db_xref="InterPro:IPR009056"
FT                   /db_xref="InterPro:IPR036909"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JY98"
FT                   /protein_id="ABA50989.1"
FT                   /translation="MRARQRLFDGPRDDRRRQPGRGRREPRAGRREGRQGVPVHQAAGC
FT                   AGADGGDARERRVGGRGARDGARRRDGGGGAGFERHRDAAIGAGAGFQFVERASGQSEG
FT                   GDAVTIAKRVKRTMSAAAAAMAVVSCAMAAAPAAHADAGDGLKVARSNACMGCHAVDRK
FT                   LVGPSFQQIAERYKNDKQAEPKLAKKVKDGGSGVWGAIPMPAHPRMSDADVRSVVQWVL
FT                   AGAPSK"
     MRARQRLFDG PRDDRRRQPG RGRREPRAGR REGRQGVPVH QAAGCAGADG GDARERRVGG        60
     RGARDGARRR DGGGGAGFER HRDAAIGAGA GFQFVERASG QSEGGDAVTI AKRVKRTMSA       120
     AAAAMAVVSC AMAAAPAAHA DAGDGLKVAR SNACMGCHAV DRKLVGPSFQ QIAERYKNDK       180
     QAEPKLAKKV KDGGSGVWGA IPMPAHPRMS DADVRSVVQW VLAGAPSK                    228
//

If you have problems or comments...

PBIL Back to PBIL home page