(data stored in SCRATCH9089 zone)

EMBL: CP000124.PE320

CP000124.PE320       Location/Qualifiers
FT   CDS             341504..342052
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_0327"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0327"
FT                   /db_xref="EnsemblGenomes-Tr:ABA50765"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JXG0"
FT                   /protein_id="ABA50765.1"
FT                   /translation="MRLGSIRACGVEAGRDLAQRRRVRFPSGIVAREQMLANGQRERGA
FT                   VEWVLEQQLRPQAKRAQRAGREFAHGHVLHDVLDERHVGEHAVGREQRLDRLVVGRSFE
FT                   AAQDLQHAAEVQQQRAPCVSFFHGDVSGRVAGRMRGNGRPRPGAAGGCPAAGLTGAETP
FT                   PARCDMSCRVARGVRCIQA"
     MRLGSIRACG VEAGRDLAQR RRVRFPSGIV AREQMLANGQ RERGAVEWVL EQQLRPQAKR        60
     AQRAGREFAH GHVLHDVLDE RHVGEHAVGR EQRLDRLVVG RSFEAAQDLQ HAAEVQQQRA       120
     PCVSFFHGDV SGRVAGRMRG NGRPRPGAAG GCPAAGLTGA ETPPARCDMS CRVARGVRCI       180
     QA                                                                      182
//

If you have problems or comments...

PBIL Back to PBIL home page