(data stored in SCRATCH9089 zone)

EMBL: CP000124.PE321

CP000124.PE321       Location/Qualifiers
FT   CDS             complement(342458..343027)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_0328"
FT                   /product="putative exported protein"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0328"
FT                   /db_xref="EnsemblGenomes-Tr:ABA50441"
FT                   /db_xref="GOA:Q3JXF9"
FT                   /db_xref="InterPro:IPR012899"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JXF9"
FT                   /protein_id="ABA50441.1"
FT                   /translation="MKIERYSKGLTVISLTTALWSLGLPVAPAAPASDARAQTPCGRGD
FT                   GMGPGMMGGGYGRGMMGGYGMGPGMMRGDGMGPGMMMGFGGWPSGLDLTSEQRAKINRI
FT                   QDDTRKAHWALMGDMMDQQAKLRDLYDAPKRDGAAIDETSRAIGSLRQKMIDASVDARK
FT                   KMEAVLTSKQLDKLRAYEKQADDMSW"
     MKIERYSKGL TVISLTTALW SLGLPVAPAA PASDARAQTP CGRGDGMGPG MMGGGYGRGM        60
     MGGYGMGPGM MRGDGMGPGM MMGFGGWPSG LDLTSEQRAK INRIQDDTRK AHWALMGDMM       120
     DQQAKLRDLY DAPKRDGAAI DETSRAIGSL RQKMIDASVD ARKKMEAVLT SKQLDKLRAY       180
     EKQADDMSW                                                               189
//

If you have problems or comments...

PBIL Back to PBIL home page