(data stored in SCRATCH9089 zone)

EMBL: CP000124.PE326

CP000124.PE326       Location/Qualifiers
FT   CDS             complement(346139..347962)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_0334"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0334"
FT                   /db_xref="EnsemblGenomes-Tr:ABA50731"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JXF4"
FT                   /protein_id="ABA50731.1"
FT                   /translation="MEFRPIKESDLGSTYDIRFPVTENRILPHQIHLLERDRVLEQLRS
FT                   GFGVLAIEGDAAVGYCTATGSGGPGKRSWRTAPKHCHAGPRRLRERAALAVAAPMAARS
FT                   RPRGCVTCKAPSAERRSSSETSCASARTGRRALRPILGFRRASASRPSSLAPRAAEPSA
FT                   DNDGPRAQTDSPRGHARLFFADAIGNARARSRRPLTASSHAIRRALAQRPITLRPPIPE
FT                   HAPAAPPIRERIEIEFGRRDRLAVPIAFDDHLAVRARDERAAVKHDLARCAALDADPIA
FT                   RGNRHQVRGRMPALRVVPMRARIDRRIVRLAADRARVQQQLRARERHCPRALRKPLIPA
FT                   DPDADPPVCGIPYAKARVARREIVFLRVARAVRNVRLSIDAERAAVRVEDRDRVELRLA
FT                   GALEEAHRQHDAELARERREAHKPRMAFIRLREREMRGVLVDAEIRRLEQFLQQHDLRA
FT                   ARGRVAHESLGARQVCVDVPVASHLRDGNGRLSHCARLRIDAAWANTAPARRGRPSPRR
FT                   ARLRRADTGRTGADRRTARSSRRAPRARRASRSADTAGCSRPPAASRCAPRMRRPPLAA
FT                   MRAPCAGTRRAARACGRADRTRSHPAPPTRE"
     MEFRPIKESD LGSTYDIRFP VTENRILPHQ IHLLERDRVL EQLRSGFGVL AIEGDAAVGY        60
     CTATGSGGPG KRSWRTAPKH CHAGPRRLRE RAALAVAAPM AARSRPRGCV TCKAPSAERR       120
     SSSETSCASA RTGRRALRPI LGFRRASASR PSSLAPRAAE PSADNDGPRA QTDSPRGHAR       180
     LFFADAIGNA RARSRRPLTA SSHAIRRALA QRPITLRPPI PEHAPAAPPI RERIEIEFGR       240
     RDRLAVPIAF DDHLAVRARD ERAAVKHDLA RCAALDADPI ARGNRHQVRG RMPALRVVPM       300
     RARIDRRIVR LAADRARVQQ QLRARERHCP RALRKPLIPA DPDADPPVCG IPYAKARVAR       360
     REIVFLRVAR AVRNVRLSID AERAAVRVED RDRVELRLAG ALEEAHRQHD AELARERREA       420
     HKPRMAFIRL REREMRGVLV DAEIRRLEQF LQQHDLRAAR GRVAHESLGA RQVCVDVPVA       480
     SHLRDGNGRL SHCARLRIDA AWANTAPARR GRPSPRRARL RRADTGRTGA DRRTARSSRR       540
     APRARRASRS ADTAGCSRPP AASRCAPRMR RPPLAAMRAP CAGTRRAARA CGRADRTRSH       600
     PAPPTRE                                                                 607
//

If you have problems or comments...

PBIL Back to PBIL home page