(data stored in SCRATCH9089 zone)

EMBL: CP000124.PE327

CP000124.PE327       Location/Qualifiers
FT   CDS             346487..347362
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_0333"
FT                   /product="hydrolase, carbon-nitrogen family"
FT                   /note="identified by match to protein family HMM PF00795"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0333"
FT                   /db_xref="EnsemblGenomes-Tr:ABA50045"
FT                   /db_xref="GOA:Q3JXF3"
FT                   /db_xref="InterPro:IPR003010"
FT                   /db_xref="InterPro:IPR017755"
FT                   /db_xref="InterPro:IPR036526"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JXF3"
FT                   /protein_id="ABA50045.1"
FT                   /translation="MRKTTVAVTQMACDWNVDANLSRAERLVRDAAARGAQIVLLQELF
FT                   ETPYFCIDQHPAHLALAQPYEGHPWLMRFASLARELGVVLPVSFFERAGQTQFNSVAIF
FT                   DADGRALGIYRKTHIPDGPGYTEKYYFTPGDTGFRVWDTAYGRIGVGICWDQWFPECAR
FT                   AMALAGAELLLYPSAIGSEPHDASIDSRAHWHNAQRGHAAANLMPVAASNRVGVERGAS
FT                   GEIVFYGSSFIAGADGEMIVECDRHGEAIATAEFDLDALAYRRRGWGVFRDRRPECYRA
FT                   LSEGAADRVR"
     MRKTTVAVTQ MACDWNVDAN LSRAERLVRD AAARGAQIVL LQELFETPYF CIDQHPAHLA        60
     LAQPYEGHPW LMRFASLARE LGVVLPVSFF ERAGQTQFNS VAIFDADGRA LGIYRKTHIP       120
     DGPGYTEKYY FTPGDTGFRV WDTAYGRIGV GICWDQWFPE CARAMALAGA ELLLYPSAIG       180
     SEPHDASIDS RAHWHNAQRG HAAANLMPVA ASNRVGVERG ASGEIVFYGS SFIAGADGEM       240
     IVECDRHGEA IATAEFDLDA LAYRRRGWGV FRDRRPECYR ALSEGAADRV R                291
//

If you have problems or comments...

PBIL Back to PBIL home page