(data stored in SCRATCH9089 zone)

EMBL: CP000124.PE328

CP000124.PE328       Location/Qualifiers
FT   CDS             348361..349452
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_0335"
FT                   /product="Phage portal protein"
FT                   /note="identified by match to protein family HMM PF04860;
FT                   match to protein family HMM TIGR01540"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0335"
FT                   /db_xref="EnsemblGenomes-Tr:ABA51116"
FT                   /db_xref="InterPro:IPR006430"
FT                   /db_xref="InterPro:IPR006944"
FT                   /db_xref="InterPro:IPR030935"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JXF2"
FT                   /protein_id="ABA51116.1"
FT                   /translation="MSSWRRRASTTASSACSNVTSSAATTLRNRPRQIRAPARAEVFTF
FT                   DDPTPVMNRAEILDYVECWSNGEWFEPPVSFAGLAKSFRASTHHSSALFFKANVLASTF
FT                   RPHRWLSRHAFERWALDFLTFGNGYLERRRNMVGGTLRLEPALAKYVRRKADFSGFVYV
FT                   NGWQERHEFAPDSVFQLVRPDINQEVYGLPEYLSSLHSAWLNESSTLFRRKYYENGSHA
FT                   GFILYMTDAAQKQDDVDNMRDALKNAKGPGNFRNVFMYAPGGKKDGIQLIPVSEVAAKD
FT                   EFFNIKNVTRDDLLAAHRVPPQLLGIVPSNSGGFGTPDTAARVFGRNEIRPLQARFAEL
FT                   NDWLGDEVVRFDDYEIPPAPVAA"
     MSSWRRRAST TASSACSNVT SSAATTLRNR PRQIRAPARA EVFTFDDPTP VMNRAEILDY        60
     VECWSNGEWF EPPVSFAGLA KSFRASTHHS SALFFKANVL ASTFRPHRWL SRHAFERWAL       120
     DFLTFGNGYL ERRRNMVGGT LRLEPALAKY VRRKADFSGF VYVNGWQERH EFAPDSVFQL       180
     VRPDINQEVY GLPEYLSSLH SAWLNESSTL FRRKYYENGS HAGFILYMTD AAQKQDDVDN       240
     MRDALKNAKG PGNFRNVFMY APGGKKDGIQ LIPVSEVAAK DEFFNIKNVT RDDLLAAHRV       300
     PPQLLGIVPS NSGGFGTPDT AARVFGRNEI RPLQARFAEL NDWLGDEVVR FDDYEIPPAP       360
     VAA                                                                     363
//

If you have problems or comments...

PBIL Back to PBIL home page