(data stored in SCRATCH9089 zone)

EMBL: CP000124.PE33

CP000124.PE33        Location/Qualifiers
FT   CDS             complement(43075..43875)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_0039"
FT                   /product="Putative phospholipid-binding domain family"
FT                   /note="identified by match to protein family HMM PF04972"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0039"
FT                   /db_xref="EnsemblGenomes-Tr:ABA48758"
FT                   /db_xref="InterPro:IPR007055"
FT                   /db_xref="InterPro:IPR014004"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JY97"
FT                   /protein_id="ABA48758.1"
FT                   /translation="MSNSRVRQTLVRTTLVIGLSAGLAATLQGCVLAVAGAAAGGGALV
FT                   ATDRRTLGAQTEDREIQVKALTQMNNGLPDGSHVNVTVFNRRVLLTGEVPSDAAKQRAE
FT                   EIVRAINNVNAIVNELAVGPASSLSDRANDSYLEGRVKTAMIAEKGISANNYKVVCERG
FT                   NVYLMGLVTTDEGSRGADVASRVPGVEKVVKVFQYIKPQDAQALTAATPASGASAAAAP
FT                   ATAPEGATVGAVPDSSVTATPLSAPAPVSNSSNVHPGNPKAGTP"
     MSNSRVRQTL VRTTLVIGLS AGLAATLQGC VLAVAGAAAG GGALVATDRR TLGAQTEDRE        60
     IQVKALTQMN NGLPDGSHVN VTVFNRRVLL TGEVPSDAAK QRAEEIVRAI NNVNAIVNEL       120
     AVGPASSLSD RANDSYLEGR VKTAMIAEKG ISANNYKVVC ERGNVYLMGL VTTDEGSRGA       180
     DVASRVPGVE KVVKVFQYIK PQDAQALTAA TPASGASAAA APATAPEGAT VGAVPDSSVT       240
     ATPLSAPAPV SNSSNVHPGN PKAGTP                                            266
//

If you have problems or comments...

PBIL Back to PBIL home page