(data stored in SCRATCH9089 zone)

EMBL: CP000124.PE332

CP000124.PE332       Location/Qualifiers
FT   CDS             354753..355622
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_0340"
FT                   /product="Patatin-like phospholipase family protein"
FT                   /note="identified by match to protein family HMM PF01734"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0340"
FT                   /db_xref="EnsemblGenomes-Tr:ABA49922"
FT                   /db_xref="GOA:Q3JXE8"
FT                   /db_xref="InterPro:IPR002641"
FT                   /db_xref="InterPro:IPR016035"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JXE8"
FT                   /protein_id="ABA49922.1"
FT                   /translation="MFDQVVFAGGGNRCWWQAGFWDVVRPALDLRPRVIAGISAGAATA
FT                   CMLYTRDSRWVMRYYEEALRHNRRNVHWGNLLRAEPVFPHYRIYRQALLDIYGEPFAKL
FT                   AGAPDIRIGVSHVPRWLGARSAVAAGLIAYNIEKYVRKTLHPTLGRSLGFRPEFVRAQD
FT                   CARVDELADLVLQSSCTPPFTPVLRRDGRPVLDGGMVDNVPVGALDASPGAVLVMVTRR
FT                   YPRPQTFVVDGGGQRRLYVQPSSKVPISSWDYTSPHQMQHAYDLGRRDGERFVGAMPQC
FT                   LDEDGAVR"
     MFDQVVFAGG GNRCWWQAGF WDVVRPALDL RPRVIAGISA GAATACMLYT RDSRWVMRYY        60
     EEALRHNRRN VHWGNLLRAE PVFPHYRIYR QALLDIYGEP FAKLAGAPDI RIGVSHVPRW       120
     LGARSAVAAG LIAYNIEKYV RKTLHPTLGR SLGFRPEFVR AQDCARVDEL ADLVLQSSCT       180
     PPFTPVLRRD GRPVLDGGMV DNVPVGALDA SPGAVLVMVT RRYPRPQTFV VDGGGQRRLY       240
     VQPSSKVPIS SWDYTSPHQM QHAYDLGRRD GERFVGAMPQ CLDEDGAVR                   289
//

If you have problems or comments...

PBIL Back to PBIL home page