(data stored in SCRATCH9089 zone)

EMBL: CP000124.PE334

CP000124.PE334       Location/Qualifiers
FT   CDS             357198..358253
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_0342"
FT                   /product="LysR family transcription regulatory protein"
FT                   /note="identified by match to protein family HMM PF00126;
FT                   match to protein family HMM PF03466"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0342"
FT                   /db_xref="EnsemblGenomes-Tr:ABA47883"
FT                   /db_xref="GOA:Q3JXE6"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JXE6"
FT                   /protein_id="ABA47883.1"
FT                   /translation="MDHLQSMRVFVKVADLGSFARAASAMDISNAVATRHVADLEGRLG
FT                   TRLLNRTTRSLSLTESGQVYLERARQILDELEDVEQMVVARNHEPVGTLRVVAPVVFGL
FT                   HNLAPVLQTYTQRFPKVIPDLTLVDRQVDLVEEGFDVGIVITRQMRSASIVTRRLTTGC
FT                   MVVCATPSYLEKHGMPTHPEQLVEHPCLSLPSEYWGDERVFTGPDGEVRVRPSNVVVAN
FT                   NTEMLRQFAMLGMGVAILPSYLIGSDIARGKLVRLLSDYRLPQVEINIAYPSRRHLPAK
FT                   VRTFIDHLVEHFSQSPDTMLGEQWATQGVAGQHVDALPADALAERSSADPALSPRLPRA
FT                   PRARTVVPSPL"
     MDHLQSMRVF VKVADLGSFA RAASAMDISN AVATRHVADL EGRLGTRLLN RTTRSLSLTE        60
     SGQVYLERAR QILDELEDVE QMVVARNHEP VGTLRVVAPV VFGLHNLAPV LQTYTQRFPK       120
     VIPDLTLVDR QVDLVEEGFD VGIVITRQMR SASIVTRRLT TGCMVVCATP SYLEKHGMPT       180
     HPEQLVEHPC LSLPSEYWGD ERVFTGPDGE VRVRPSNVVV ANNTEMLRQF AMLGMGVAIL       240
     PSYLIGSDIA RGKLVRLLSD YRLPQVEINI AYPSRRHLPA KVRTFIDHLV EHFSQSPDTM       300
     LGEQWATQGV AGQHVDALPA DALAERSSAD PALSPRLPRA PRARTVVPSP L                351
//

If you have problems or comments...

PBIL Back to PBIL home page