(data stored in SCRATCH9089 zone)

EMBL: CP000124.PE351

CP000124.PE351       Location/Qualifiers
FT   CDS             complement(375211..376347)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_0360"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0360"
FT                   /db_xref="EnsemblGenomes-Tr:ABA49777"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JXC9"
FT                   /protein_id="ABA49777.1"
FT                   /translation="MSVRRPGRLRRRRAARPRLLRGRELAILERRRVVALRGGGRIVRA
FT                   GDVEIAHDAVAAALVERRGHVLRNRLARVGRALVPGKRLPVVARRTAPVEKLVRERELG
FT                   LHVPLLRGLQEPVVRGRRIARDEFAVVEHPAVHVLRLRHPRIGRAPQPAQSFRHVRRHA
FT                   LTVDQHHRVIERGETVAARRRIVKLHERRAQIARVVVGHRHFGLALRVEPARRARRLRE
FT                   RAARRRTERRRGERTDYRAAQHTRRARGERRAAAFPAHPRTSCSACRVARSSHTTSADN
FT                   ATTRNPASRDWRAPAVSAAKMPTGTPARRPAASTCSSAAATSGCFVSPRCPRLADRSAG
FT                   PTNTQSTPGVAAIRSASSTPRADSICTIVAICAFAVCT"
     MSVRRPGRLR RRRAARPRLL RGRELAILER RRVVALRGGG RIVRAGDVEI AHDAVAAALV        60
     ERRGHVLRNR LARVGRALVP GKRLPVVARR TAPVEKLVRE RELGLHVPLL RGLQEPVVRG       120
     RRIARDEFAV VEHPAVHVLR LRHPRIGRAP QPAQSFRHVR RHALTVDQHH RVIERGETVA       180
     ARRRIVKLHE RRAQIARVVV GHRHFGLALR VEPARRARRL RERAARRRTE RRRGERTDYR       240
     AAQHTRRARG ERRAAAFPAH PRTSCSACRV ARSSHTTSAD NATTRNPASR DWRAPAVSAA       300
     KMPTGTPARR PAASTCSSAA ATSGCFVSPR CPRLADRSAG PTNTQSTPGV AAIRSASSTP       360
     RADSICTIVA ICAFAVCT                                                     378
//

If you have problems or comments...

PBIL Back to PBIL home page