(data stored in SCRATCH9089 zone)

EMBL: CP000124.PE37

CP000124.PE37        Location/Qualifiers
FT   CDS             complement(46058..46693)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_0043"
FT                   /product="rare lipoprotein A family protein"
FT                   /note="identified by match to protein family HMM PF03330;
FT                   match to protein family HMM TIGR00413"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0043"
FT                   /db_xref="EnsemblGenomes-Tr:ABA49285"
FT                   /db_xref="GOA:Q3JY93"
FT                   /db_xref="InterPro:IPR009009"
FT                   /db_xref="InterPro:IPR012997"
FT                   /db_xref="InterPro:IPR034718"
FT                   /db_xref="InterPro:IPR036908"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JY93"
FT                   /protein_id="ABA49285.1"
FT                   /translation="MKFRLPRHLGTLAVFFALTGCAVPPNAPTSEQAKSAASKDALRTA
FT                   ASGAASNNKESAGAPLNFDTALASMPAAGSQDVSRQSLADAKPIDAADISDFRQTGRAS
FT                   WYGKGFHGRRTANGERFNMNEFTAAHRTLPLASYVRVTNQANGKSVVVKINDRGPFSRG
FT                   RILDLSYAAAKVIGLVHAGTARVKIQGLSPEEARVARDEMLASNSTTK"
     MKFRLPRHLG TLAVFFALTG CAVPPNAPTS EQAKSAASKD ALRTAASGAA SNNKESAGAP        60
     LNFDTALASM PAAGSQDVSR QSLADAKPID AADISDFRQT GRASWYGKGF HGRRTANGER       120
     FNMNEFTAAH RTLPLASYVR VTNQANGKSV VVKINDRGPF SRGRILDLSY AAAKVIGLVH       180
     AGTARVKIQG LSPEEARVAR DEMLASNSTT K                                      211
//

If you have problems or comments...

PBIL Back to PBIL home page