(data stored in SCRATCH9089 zone)

EMBL: CP000124.PE370

CP000124.PE370       Location/Qualifiers
FT   CDS             396779..398086
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_0379"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0379"
FT                   /db_xref="EnsemblGenomes-Tr:ABA49821"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JXB0"
FT                   /protein_id="ABA49821.1"
FT                   /translation="MAGQVPGDPDGADAEPLVALQVAARILDEDGVRQARVRRAHRPAQ
FT                   HRGVGLRAPCAAIAHLLDRDHALEQAVDLQLAQHRARIGFGGVRQHDLAAGQRSDEPRE
FT                   PALGAHHRRQVGERVDDLQEIVRIDRVMAREAEERRAVAARVVGAQMIGVRALDFQRID
FT                   DVLRHRPVDRREDRMRRVVQRVVEIEEPDGAARLRAGAPPARSLGRLLARRRRGGAARL
FT                   AARAQCERIIVPNGCSVRISSSTECSMRPSTIWTDFTPLFAASSADEIFGSMPPEIVPS
FT                   SKSASISRADRSVSRLPSLSITPGMLVIITSFSAFSTVASLPATRSALMLYDRPSSPKP
FT                   IGEITGMNASSCSAFTTAGLIASTSPTWPMSTYSPGLSRSGIISLRAWMRPPSLPVRPT
FT                   AWPPKWLISVTMSCCTSPPSTHSTTSIVSSSVTRIP"
     MAGQVPGDPD GADAEPLVAL QVAARILDED GVRQARVRRA HRPAQHRGVG LRAPCAAIAH        60
     LLDRDHALEQ AVDLQLAQHR ARIGFGGVRQ HDLAAGQRSD EPREPALGAH HRRQVGERVD       120
     DLQEIVRIDR VMAREAEERR AVAARVVGAQ MIGVRALDFQ RIDDVLRHRP VDRREDRMRR       180
     VVQRVVEIEE PDGAARLRAG APPARSLGRL LARRRRGGAA RLAARAQCER IIVPNGCSVR       240
     ISSSTECSMR PSTIWTDFTP LFAASSADEI FGSMPPEIVP SSKSASISRA DRSVSRLPSL       300
     SITPGMLVII TSFSAFSTVA SLPATRSALM LYDRPSSPKP IGEITGMNAS SCSAFTTAGL       360
     IASTSPTWPM STYSPGLSRS GIISLRAWMR PPSLPVRPTA WPPKWLISVT MSCCTSPPST       420
     HSTTSIVSSS VTRIP                                                        435
//

If you have problems or comments...

PBIL Back to PBIL home page