(data stored in SCRATCH9089 zone)

EMBL: CP000124.PE373

CP000124.PE373       Location/Qualifiers
FT   CDS             398680..398931
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_0381"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0381"
FT                   /db_xref="EnsemblGenomes-Tr:ABA48216"
FT                   /db_xref="InterPro:IPR032720"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JXA7"
FT                   /protein_id="ABA48216.1"
FT                   /translation="MTEPAATPGLISKRCPRCGSAFDCGARTRPFTCWCAAMPAMPAGA
FT                   QPATGARCLCPACLADEIARRVAASTAGEGPARPERED"
     MTEPAATPGL ISKRCPRCGS AFDCGARTRP FTCWCAAMPA MPAGAQPATG ARCLCPACLA        60
     DEIARRVAAS TAGEGPARPE RED                                                83
//

If you have problems or comments...

PBIL Back to PBIL home page