(data stored in SCRATCH9089 zone)

EMBL: CP000124.PE377

CP000124.PE377       Location/Qualifiers
FT   CDS             complement(402562..403206)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_0386"
FT                   /product="ATP-dependent protease hslV"
FT                   /EC_number="3.4.25.-"
FT                   /EC_number="3.4.-.-"
FT                   /note="identified by match to protein family HMM PF00227"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0386"
FT                   /db_xref="EnsemblGenomes-Tr:ABA47467"
FT                   /db_xref="GOA:Q3JXA3"
FT                   /db_xref="InterPro:IPR001353"
FT                   /db_xref="InterPro:IPR022281"
FT                   /db_xref="InterPro:IPR023333"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JXA3"
FT                   /protein_id="ABA47467.1"
FT                   /translation="MKAMRVEPAGQARSRAPQHAAAPRAPRLSRLSRGIQMEQFHGTTI
FT                   LSVRRGDKVALGGDGQVTLGNIVMKGGARKVRRIYNNQVLVGFAGGTADAFSLLDRFEA
FT                   KLEKHQGNLTRAAVELAKDWRTDRLLRRLEAMLIAADATTTLVITGNGDVLDPEGGICA
FT                   IGSGGSYAQAAARALAENTDLSPREIVEKALGIAGDMCIYTNHNRIIETIE"
     MKAMRVEPAG QARSRAPQHA AAPRAPRLSR LSRGIQMEQF HGTTILSVRR GDKVALGGDG        60
     QVTLGNIVMK GGARKVRRIY NNQVLVGFAG GTADAFSLLD RFEAKLEKHQ GNLTRAAVEL       120
     AKDWRTDRLL RRLEAMLIAA DATTTLVITG NGDVLDPEGG ICAIGSGGSY AQAAARALAE       180
     NTDLSPREIV EKALGIAGDM CIYTNHNRII ETIE                                   214
//

If you have problems or comments...

PBIL Back to PBIL home page