(data stored in SCRATCH9089 zone)

EMBL: CP000124.PE379

CP000124.PE379       Location/Qualifiers
FT   CDS             404223..405440
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_0388"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0388"
FT                   /db_xref="EnsemblGenomes-Tr:ABA50312"
FT                   /db_xref="GOA:Q3JXA1"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JXA1"
FT                   /protein_id="ABA50312.1"
FT                   /translation="MAGERRAPPVAHAPLTRRRRAAAASPRTMRRGLCEAGVEAVGDEV
FT                   ARQVDADEHHLVGLLLGRQPLRGEIAAHHLMHALEHDLAVDALHVQHALVAQHPLAVDL
FT                   QNAAEEILELVRIERAIVAVDERLDLVVVVRVVMIVVAVPVIVLAMAVIVIAMRVIVVV
FT                   IVVMRVRVIVFREEVRIDLELRVQVEAAQVEDLLDVRIAEVHDLDRRLRVHVQQAVLEL
FT                   GHRLVVDEVRLRDEQAIGEADLALHDFVLVELRVRMLRVDERDDRVEQEFVGDLAVDEE
FT                   RLRDRARIREARRLDHHAVEVERAVALFRGEVGERAREVAANRAADAAVAHLDDLLGRI
FT                   LDEDLVVDVLFAELVFDHGDLHAVLFVQDALEQRGLAAAEKAREDGDGNGHVVGRLWFV
FT                   KRGQNG"
     MAGERRAPPV AHAPLTRRRR AAAASPRTMR RGLCEAGVEA VGDEVARQVD ADEHHLVGLL        60
     LGRQPLRGEI AAHHLMHALE HDLAVDALHV QHALVAQHPL AVDLQNAAEE ILELVRIERA       120
     IVAVDERLDL VVVVRVVMIV VAVPVIVLAM AVIVIAMRVI VVVIVVMRVR VIVFREEVRI       180
     DLELRVQVEA AQVEDLLDVR IAEVHDLDRR LRVHVQQAVL ELGHRLVVDE VRLRDEQAIG       240
     EADLALHDFV LVELRVRMLR VDERDDRVEQ EFVGDLAVDE ERLRDRARIR EARRLDHHAV       300
     EVERAVALFR GEVGERAREV AANRAADAAV AHLDDLLGRI LDEDLVVDVL FAELVFDHGD       360
     LHAVLFVQDA LEQRGLAAAE KAREDGDGNG HVVGRLWFVK RGQNG                       405
//

If you have problems or comments...

PBIL Back to PBIL home page