(data stored in SCRATCH9089 zone)

EMBL: CP000124.PE384

CP000124.PE384       Location/Qualifiers
FT   CDS             complement(407909..409564)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_0393"
FT                   /product="Protein of unknown function, DUF484 family"
FT                   /note="identified by match to protein family HMM PF04340"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0393"
FT                   /db_xref="EnsemblGenomes-Tr:ABA50035"
FT                   /db_xref="InterPro:IPR007435"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JX96"
FT                   /protein_id="ABA50035.1"
FT                   /translation="MPAAYNSAHETLVHQDARRGQRLRRARRLHPRAAPAHRRAGARAR
FT                   RPPLRDRRRSVAARRKADRRRRRFQIPDLQLRRRRSRALRQRRALLRQVRPRPRAHRQG
FT                   ERARRGEARRDHADDAGQRRGRRRHGRARVRAGARAVRRERPRRPPRGRRHALAAARER
FT                   RDALDLGRVDGQSARGADRRRRRGVRGARRRAGDRARSAFPAARERGLHADRVASRSEP
FT                   ARLRARRGRNARVRHGRVRGRRGRHPARATRFARHGPYARRHADDLVERRVRRARAAHD
FT                   GRPRDHRLRRRDRAARLTFNSQTFHLPKPERSAMNDREVADYLLANPEFFAQHAELLAT
FT                   IKLANPHGKAAVSLQERQMEMLREKNKHLERRLAELLRYGHENDGLAAKFNRWTARVIA
FT                   ERDPYALPRAIAGGLADVFDVPQTALRLWDVAETYAQADFARNVGEEVRLFTNSLATPY
FT                   CGANTGFEAAQWLTPVAAPPAADDGEAPAASGAAESVALIALRASAEGEGAGAFGLLVL
FT                   GSPDPRRFHDGMGTDFLTQIGTLASAALTRLLPH"
     MPAAYNSAHE TLVHQDARRG QRLRRARRLH PRAAPAHRRA GARARRPPLR DRRRSVAARR        60
     KADRRRRRFQ IPDLQLRRRR SRALRQRRAL LRQVRPRPRA HRQGERARRG EARRDHADDA       120
     GQRRGRRRHG RARVRAGARA VRRERPRRPP RGRRHALAAA RERRDALDLG RVDGQSARGA       180
     DRRRRRGVRG ARRRAGDRAR SAFPAARERG LHADRVASRS EPARLRARRG RNARVRHGRV       240
     RGRRGRHPAR ATRFARHGPY ARRHADDLVE RRVRRARAAH DGRPRDHRLR RRDRAARLTF       300
     NSQTFHLPKP ERSAMNDREV ADYLLANPEF FAQHAELLAT IKLANPHGKA AVSLQERQME       360
     MLREKNKHLE RRLAELLRYG HENDGLAAKF NRWTARVIAE RDPYALPRAI AGGLADVFDV       420
     PQTALRLWDV AETYAQADFA RNVGEEVRLF TNSLATPYCG ANTGFEAAQW LTPVAAPPAA       480
     DDGEAPAASG AAESVALIAL RASAEGEGAG AFGLLVLGSP DPRRFHDGMG TDFLTQIGTL       540
     ASAALTRLLP H                                                            551
//

If you have problems or comments...

PBIL Back to PBIL home page