(data stored in SCRATCH9089 zone)

EMBL: CP000124.PE389

CP000124.PE389       Location/Qualifiers
FT   CDS             413736..414104
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_0398"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0398"
FT                   /db_xref="EnsemblGenomes-Tr:ABA48155"
FT                   /db_xref="InterPro:IPR002002"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JX91"
FT                   /protein_id="ABA48155.1"
FT                   /translation="MSRGDALRRQSRRRPRLPPEETGGPHAAARFVSASGRRVRQRLPL
FT                   GIDSPISPTSVATTPPAISMIVFVEGEPVKKRATPSLIEWNDWPPKYSSTTPPTMSATE
FT                   IARVMKILAETDDEDAAV"
     MSRGDALRRQ SRRRPRLPPE ETGGPHAAAR FVSASGRRVR QRLPLGIDSP ISPTSVATTP        60
     PAISMIVFVE GEPVKKRATP SLIEWNDWPP KYSSTTPPTM SATEIARVMK ILAETDDEDA       120
     AV                                                                      122
//

If you have problems or comments...

PBIL Back to PBIL home page