(data stored in SCRATCH9089 zone)

EMBL: CP000124.PE39

CP000124.PE39        Location/Qualifiers
FT   CDS             48132..49508
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_0045"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0045"
FT                   /db_xref="EnsemblGenomes-Tr:ABA50887"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JY91"
FT                   /protein_id="ABA50887.1"
FT                   /translation="MVEDAARSVGRMPARFAGARGRARRVRRMGRGAARQARVRRDAGG
FT                   LRFHVHVLVHDALHRALPVFVVGARHQDARVRDHRPAVPEGDQAALPEALVRRLSAHAR
FT                   RARRCDRARRALLQHARRPARAADGEGVGAARRRSGRISTKCRRRPEKLANIARFNGSR
FT                   LPFFSPASTIAKCCSRFGGAGDPRYLFAKNPSPVAARRAPLRAGDLRSGRPLQHAVLAP
FT                   HQGHGAVRRDPALHRAARPREARAPYLRARARPPDPAQRRRRRAVRAGDRDLPRGDRVL
FT                   QHDGRSRLHPQDRRAGHQGLRHLPARTDLQDSRRLASPHERRAARDQVRHAVAALTRGR
FT                   VRRRLRLVAPGYVGWAGSCRAASAIAPARARRPGARRAPRHAQRRAALFCIALAPDQDS
FT                   RPTAAASLDASARDMPRRRAPNCRFNASISKRAAGSWPPCRSRLASGASVMSISSPVLR
FT                   "
     MVEDAARSVG RMPARFAGAR GRARRVRRMG RGAARQARVR RDAGGLRFHV HVLVHDALHR        60
     ALPVFVVGAR HQDARVRDHR PAVPEGDQAA LPEALVRRLS AHARRARRCD RARRALLQHA       120
     RRPARAADGE GVGAARRRSG RISTKCRRRP EKLANIARFN GSRLPFFSPA STIAKCCSRF       180
     GGAGDPRYLF AKNPSPVAAR RAPLRAGDLR SGRPLQHAVL APHQGHGAVR RDPALHRAAR       240
     PREARAPYLR ARARPPDPAQ RRRRRAVRAG DRDLPRGDRV LQHDGRSRLH PQDRRAGHQG       300
     LRHLPARTDL QDSRRLASPH ERRAARDQVR HAVAALTRGR VRRRLRLVAP GYVGWAGSCR       360
     AASAIAPARA RRPGARRAPR HAQRRAALFC IALAPDQDSR PTAAASLDAS ARDMPRRRAP       420
     NCRFNASISK RAAGSWPPCR SRLASGASVM SISSPVLR                               458
//

If you have problems or comments...

PBIL Back to PBIL home page