(data stored in SCRATCH9089 zone)

EMBL: CP000124.PE399

CP000124.PE399       Location/Qualifiers
FT   CDS             420373..421944
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_0408"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0408"
FT                   /db_xref="EnsemblGenomes-Tr:ABA50173"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JX81"
FT                   /protein_id="ABA50173.1"
FT                   /translation="MQHRRAAGCRRAFVRAARRLPAGCPTPGRARRRAPSSAAPEHAPA
FT                   ASSAGGPSLAMRASELQHQLEDRREALAVRRRDHRARVQARLREHGLHLRERDEAVVAV
FT                   VRAHPARADAAERQRAARDVHQRVVDRHAARDRVAHHALDGRAVFVEQIQRERPRPRVH
FT                   VGDRIVERVVRNDRQQRPEDLFLHQLRRIGRLRDEHGRQAAQRGIGRRVRERMELRARL
FT                   LRFAREPLQPCEVALGDDRRIVRVRRQIRIEPSHPRARARDEFGFLAARHEHIVGRDAG
FT                   LARVQRLAGDDGVDRRVEARARPDDHGRLAAQLERDGREVLGGRAHHVPADVRRAGEEQ
FT                   MIERQPAERRADLRIAVDHRDVIAREGFRDQFLEQLRRARRQFGHLDDRAIAGGERADE
FT                   RARGEQHRVVPRHDDADDAERLWHHLRARGAQPLVHRPALRLDPALAVLERLVDFLFRE
FT                   PDLGHQHFFLRAMAEVRVDRGGERIAVLEQHLAQRAQVVGARRPRRVRRAQIGGALVAQ
FT                   QRVERG"
     MQHRRAAGCR RAFVRAARRL PAGCPTPGRA RRRAPSSAAP EHAPAASSAG GPSLAMRASE        60
     LQHQLEDRRE ALAVRRRDHR ARVQARLREH GLHLRERDEA VVAVVRAHPA RADAAERQRA       120
     ARDVHQRVVD RHAARDRVAH HALDGRAVFV EQIQRERPRP RVHVGDRIVE RVVRNDRQQR       180
     PEDLFLHQLR RIGRLRDEHG RQAAQRGIGR RVRERMELRA RLLRFAREPL QPCEVALGDD       240
     RRIVRVRRQI RIEPSHPRAR ARDEFGFLAA RHEHIVGRDA GLARVQRLAG DDGVDRRVEA       300
     RARPDDHGRL AAQLERDGRE VLGGRAHHVP ADVRRAGEEQ MIERQPAERR ADLRIAVDHR       360
     DVIAREGFRD QFLEQLRRAR RQFGHLDDRA IAGGERADER ARGEQHRVVP RHDDADDAER       420
     LWHHLRARGA QPLVHRPALR LDPALAVLER LVDFLFREPD LGHQHFFLRA MAEVRVDRGG       480
     ERIAVLEQHL AQRAQVVGAR RPRRVRRAQI GGALVAQQRV ERG                         523
//

If you have problems or comments...

PBIL Back to PBIL home page