(data stored in SCRATCH9089 zone)

EMBL: CP000124.PE40

CP000124.PE40        Location/Qualifiers
FT   CDS             48682..49140
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lrp"
FT                   /locus_tag="BURPS1710b_0046"
FT                   /product="transcriptional regulator, AsnC family"
FT                   /note="identified by match to protein family HMM PF01037"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0046"
FT                   /db_xref="EnsemblGenomes-Tr:ABA47733"
FT                   /db_xref="GOA:Q3JY90"
FT                   /db_xref="InterPro:IPR000485"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR019885"
FT                   /db_xref="InterPro:IPR019887"
FT                   /db_xref="InterPro:IPR019888"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JY90"
FT                   /protein_id="ABA47733.1"
FT                   /translation="MTLDTFSQKILRLLQLDARRSVQEISDQVGLSSTPCWRRIKDMEQ
FT                   SGVIQRYTALLDREKLGLHICALAHVHLTRHNEGGVEQFEREIATCPEVTECYSTTGEA
FT                   DYILKIVAPDIKAYDIFLHERIFKIPAVSQVRTSVVLREIKFDTQLPL"
     MTLDTFSQKI LRLLQLDARR SVQEISDQVG LSSTPCWRRI KDMEQSGVIQ RYTALLDREK        60
     LGLHICALAH VHLTRHNEGG VEQFEREIAT CPEVTECYST TGEADYILKI VAPDIKAYDI       120
     FLHERIFKIP AVSQVRTSVV LREIKFDTQL PL                                     152
//

If you have problems or comments...

PBIL Back to PBIL home page