(data stored in SCRATCH9089 zone)

EMBL: CP000124.PE402

CP000124.PE402       Location/Qualifiers
FT   CDS             423914..425557
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_0411"
FT                   /product="oxidoreductase, GMC family"
FT                   /note="identified by match to protein family HMM PF00732;
FT                   match to protein family HMM PF05199"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0411"
FT                   /db_xref="EnsemblGenomes-Tr:ABA50435"
FT                   /db_xref="GOA:Q3JX78"
FT                   /db_xref="InterPro:IPR000172"
FT                   /db_xref="InterPro:IPR007867"
FT                   /db_xref="InterPro:IPR012132"
FT                   /db_xref="InterPro:IPR027424"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JX78"
FT                   /protein_id="ABA50435.1"
FT                   /translation="MQYDYIIVGGGSGGASLAGRLADACPDATIALIEAGGHTERNLLV
FT                   NMPVGIAALVPFKLGTNYGYETVPQPGLGGRRGYQPRGRGLGGSSAINAMIYTRGHPLD
FT                   YDEWEQLGCTGWGWRDVLPYFRRAEGNARGANEWHGADGPLTVSDLRFRNPFSERFIAA
FT                   AHEAGYPLNDDFNGEHQEGVGFYQVTHRDGSRCSVARAYVYGRTRPNLHVIVDATVLRV
FT                   VFDGKRATGVEFARAGRTEQLAARAEVILSAGAFNTPQLLMCSGVGPAAQLRRHGVALV
FT                   HDAPDVGENLIDHIDFIINKRVNSSELVGICMRGIAKMTPALFSYLSGRRGMMTSNVAE
FT                   AGGFIKSEPGLDRPDLQLHFCTALVDDHNRNMHWGFGYSLHVCALRPKSRGNVALASGD
FT                   ARVAPLIDPRFFSDERDLDLLVTGAKAMRRILCAAPLASQGGRELYTDPGDTDAQLRAA
FT                   IVAHADTIYHPVGTCRMGTDARAVVDPQLRVKGVDGLRVVDASVMPTLIGGNTNAPTVM
FT                   IAERAADFIVAARNGQAAPTRERVAATHGG"
     MQYDYIIVGG GSGGASLAGR LADACPDATI ALIEAGGHTE RNLLVNMPVG IAALVPFKLG        60
     TNYGYETVPQ PGLGGRRGYQ PRGRGLGGSS AINAMIYTRG HPLDYDEWEQ LGCTGWGWRD       120
     VLPYFRRAEG NARGANEWHG ADGPLTVSDL RFRNPFSERF IAAAHEAGYP LNDDFNGEHQ       180
     EGVGFYQVTH RDGSRCSVAR AYVYGRTRPN LHVIVDATVL RVVFDGKRAT GVEFARAGRT       240
     EQLAARAEVI LSAGAFNTPQ LLMCSGVGPA AQLRRHGVAL VHDAPDVGEN LIDHIDFIIN       300
     KRVNSSELVG ICMRGIAKMT PALFSYLSGR RGMMTSNVAE AGGFIKSEPG LDRPDLQLHF       360
     CTALVDDHNR NMHWGFGYSL HVCALRPKSR GNVALASGDA RVAPLIDPRF FSDERDLDLL       420
     VTGAKAMRRI LCAAPLASQG GRELYTDPGD TDAQLRAAIV AHADTIYHPV GTCRMGTDAR       480
     AVVDPQLRVK GVDGLRVVDA SVMPTLIGGN TNAPTVMIAE RAADFIVAAR NGQAAPTRER       540
     VAATHGG                                                                 547
//

If you have problems or comments...

PBIL Back to PBIL home page