(data stored in SCRATCH9089 zone)

EMBL: CP000124.PE41

CP000124.PE41        Location/Qualifiers
FT   CDS             complement(49319..50509)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_0047"
FT                   /product="cation efflux family protein"
FT                   /note="identified by match to protein family HMM PF01545;
FT                   match to protein family HMM TIGR01297"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0047"
FT                   /db_xref="EnsemblGenomes-Tr:ABA48166"
FT                   /db_xref="GOA:Q3JY89"
FT                   /db_xref="InterPro:IPR002524"
FT                   /db_xref="InterPro:IPR027469"
FT                   /db_xref="InterPro:IPR027470"
FT                   /db_xref="InterPro:IPR036837"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JY89"
FT                   /protein_id="ABA48166.1"
FT                   /translation="MSTFSNDDLASEKQVVARQSTFVSIVLNVILATLQVVVGVIAHSQ
FT                   ALIADGVHSLSDLVSDFVVLLANRHSGAKPDADHNYGHSRYETVASFFLGAILIAVGVG
FT                   MLWRAGDRLVHLEDIPPVHASALAVAVVVLLSKEGLFRYMLREAQRVRSAMLVANAWHA
FT                   RSDAASSLVVAIGIIGSLAGVRLLDPIAAAIVGFMVARMGWTFGWDALQDLSDRALDES
FT                   ASAEIRALIVSTPGVRDVHDLRTRKMGDSALVDAHILVDPMMSVSEGHYIAEAARSRAL
FT                   TDRRVLDALIHVDPEHDVARRTVLDLPPRDQLEGQIEATLEKAGLRASAINLHYLSTGL
FT                   EIDITLAPDASRDRQGGHDPAARLDIEALKRQFGARRLGMSRALASSDAAAVGRLS"
     MSTFSNDDLA SEKQVVARQS TFVSIVLNVI LATLQVVVGV IAHSQALIAD GVHSLSDLVS        60
     DFVVLLANRH SGAKPDADHN YGHSRYETVA SFFLGAILIA VGVGMLWRAG DRLVHLEDIP       120
     PVHASALAVA VVVLLSKEGL FRYMLREAQR VRSAMLVANA WHARSDAASS LVVAIGIIGS       180
     LAGVRLLDPI AAAIVGFMVA RMGWTFGWDA LQDLSDRALD ESASAEIRAL IVSTPGVRDV       240
     HDLRTRKMGD SALVDAHILV DPMMSVSEGH YIAEAARSRA LTDRRVLDAL IHVDPEHDVA       300
     RRTVLDLPPR DQLEGQIEAT LEKAGLRASA INLHYLSTGL EIDITLAPDA SRDRQGGHDP       360
     AARLDIEALK RQFGARRLGM SRALASSDAA AVGRLS                                 396
//

If you have problems or comments...

PBIL Back to PBIL home page