(data stored in SCRATCH9089 zone)

EMBL: CP000124.PE411

CP000124.PE411       Location/Qualifiers
FT   CDS             434115..435617
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_0420"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0420"
FT                   /db_xref="EnsemblGenomes-Tr:ABA51123"
FT                   /db_xref="InterPro:IPR021136"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JX69"
FT                   /protein_id="ABA51123.1"
FT                   /translation="MTGIDTAAAAILASRIDSLLDAIQPAAGGAAAPQVGTSGAPPASA
FT                   APRPAASGPPPASAQTALSEVGLTLDAISRYGGAATPAVVGAAPLLPAAPTAVAAQAAS
FT                   LDPLLATPDARAGNPAAATAPGAQAAQAAPQAALPASPAAALSLALVQAVAQSGLFYES
FT                   HLAQWLAGQRTTAELAREPQARLASGAEPDAQAGAQPGQMGDALDDALADLLAVRLPLP
FT                   QGGRDAPARGAARPPGQPAGGADEGAAASGRAPTNAAAPARSVDAYAALADADGKPGAP
FT                   SAQTALARAGMPPTGADTPASIAASLHAATLPIVRQQLDLLATDQFRWIGEAWPGARLD
FT                   WTIEPDEQHGRERPAPDADFPDARGWRTRLTLALPSLGTIDAELVLNGEQLAARLRASE
FT                   AGAARLAPHGEALRARLQALGLQVSGLSIRAIDGVPDSFDAAAARAAASAYARAAAGGE
FT                   AVAKDGFGGAAGATGGAGGAGVEHRASSSSPVETDDDWEFAQ"
     MTGIDTAAAA ILASRIDSLL DAIQPAAGGA AAPQVGTSGA PPASAAPRPA ASGPPPASAQ        60
     TALSEVGLTL DAISRYGGAA TPAVVGAAPL LPAAPTAVAA QAASLDPLLA TPDARAGNPA       120
     AATAPGAQAA QAAPQAALPA SPAAALSLAL VQAVAQSGLF YESHLAQWLA GQRTTAELAR       180
     EPQARLASGA EPDAQAGAQP GQMGDALDDA LADLLAVRLP LPQGGRDAPA RGAARPPGQP       240
     AGGADEGAAA SGRAPTNAAA PARSVDAYAA LADADGKPGA PSAQTALARA GMPPTGADTP       300
     ASIAASLHAA TLPIVRQQLD LLATDQFRWI GEAWPGARLD WTIEPDEQHG RERPAPDADF       360
     PDARGWRTRL TLALPSLGTI DAELVLNGEQ LAARLRASEA GAARLAPHGE ALRARLQALG       420
     LQVSGLSIRA IDGVPDSFDA AAARAAASAY ARAAAGGEAV AKDGFGGAAG ATGGAGGAGV       480
     EHRASSSSPV ETDDDWEFAQ                                                   500
//

If you have problems or comments...

PBIL Back to PBIL home page