(data stored in SCRATCH9089 zone)

EMBL: CP000124.PE413

CP000124.PE413       Location/Qualifiers
FT   CDS             436124..436870
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_0422"
FT                   /product="PepSY-associated TM helix family"
FT                   /note="identified by match to protein family HMM PF03929"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0422"
FT                   /db_xref="EnsemblGenomes-Tr:ABA47548"
FT                   /db_xref="GOA:Q3JX67"
FT                   /db_xref="InterPro:IPR032307"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JX67"
FT                   /protein_id="ABA47548.1"
FT                   /translation="MFCANGSRSVNAPESIEKHSGVVVPYPGSPRKLDAFELAERRRRS
FT                   RRATFIKWLRKVHGWVGLWGAALGLLFGVTGVLLNHRAPPLKISSGEPQVSQLQLALPS
FT                   PAPATPHAMAAWIRRELAFDGRLGRVRKEPAQPVAWGGRRVEQPEHWQFGLFGPRSNVQ
FT                   VEYWKGNGYVSVKRTDNAFLTALNNLHRGVGMNLFWVLLMDTIAGSMVLLSLTGVLLWT
FT                   ELNKRRTVGVVLVAGSVAAALAAGLT"
     MFCANGSRSV NAPESIEKHS GVVVPYPGSP RKLDAFELAE RRRRSRRATF IKWLRKVHGW        60
     VGLWGAALGL LFGVTGVLLN HRAPPLKISS GEPQVSQLQL ALPSPAPATP HAMAAWIRRE       120
     LAFDGRLGRV RKEPAQPVAW GGRRVEQPEH WQFGLFGPRS NVQVEYWKGN GYVSVKRTDN       180
     AFLTALNNLH RGVGMNLFWV LLMDTIAGSM VLLSLTGVLL WTELNKRRTV GVVLVAGSVA       240
     AALAAGLT                                                                248
//

If you have problems or comments...

PBIL Back to PBIL home page