(data stored in SCRATCH9089 zone)

EMBL: CP000124.PE417

CP000124.PE417       Location/Qualifiers
FT   CDS             complement(440489..441343)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BURPS1710b_0426"
FT                   /product="sensor kinase protein, putative"
FT                   /note="identified by match to protein family HMM PF02518;
FT                   match to protein family HMM PF07730"
FT                   /db_xref="EnsemblGenomes-Gn:BURPS1710b_0426"
FT                   /db_xref="EnsemblGenomes-Tr:ABA48307"
FT                   /db_xref="GOA:Q3JX63"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR011712"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q3JX63"
FT                   /protein_id="ABA48307.1"
FT                   /translation="MDTPSVAPSIASAPASSSSGLAPEVGIPFVSRCASRAPTAERLGA
FT                   RVAQLSAELVAADESARRHLAGELHDGLGADLTAARFALANVETWLPDDAPDAARRALA
FT                   LAQQALDAATAANRRLIDGLRTPALEAGLVGTLAAWIGAHGARTGLRTSFVCAADARVT
FT                   QLSADGALAVFRVAQEALANVAKHAHASAADVRIDVDDTHLSLVVTDDGVGVGVGAAAA
FT                   RRRGGYGLGSMRARCEALGGTLELASPRAGGAGTALRARFAWHALIAARMPAAARKVRK
FT                   EAR"
     MDTPSVAPSI ASAPASSSSG LAPEVGIPFV SRCASRAPTA ERLGARVAQL SAELVAADES        60
     ARRHLAGELH DGLGADLTAA RFALANVETW LPDDAPDAAR RALALAQQAL DAATAANRRL       120
     IDGLRTPALE AGLVGTLAAW IGAHGARTGL RTSFVCAADA RVTQLSADGA LAVFRVAQEA       180
     LANVAKHAHA SAADVRIDVD DTHLSLVVTD DGVGVGVGAA AARRRGGYGL GSMRARCEAL       240
     GGTLELASPR AGGAGTALRA RFAWHALIAA RMPAAARKVR KEAR                        284
//

If you have problems or comments...

PBIL Back to PBIL home page